Skip to content

Destinations

Browse by region

Cambridge
Oxford
London
York
Bath
Windsor

Edinburgh
Glasgow
Aberdeen
Inverness
St Andrews
Stirling

Dublin
Galway
Cork
Limerick
Killarney
Kilkenny

Cardiff
Swansea
Newport
Llandudno
Conwy
Snowdonia

Northern Ireland

Belfast
Derry-Londonderry

Browse all destinations

Categories

Popular categories

Punting Walking Tours Food Tours Seasonal Events Ghost Tours Day Trips Bike Tours Museums Adventure Tours Hiking Tours Historical Tours Beer & Brewery Tours Cooking Classes Photography Tours Literary Tours Escape Rooms Nature and Wildlife Tours Harry Potter Tours Game Of Thrones Tours Architecture Tours Art Tours Family-friendly Shows Bus Tours Cruises & Sailing Sporting Events Nightlife Dining Experiences Classes & Workshops Seasonal Experiences Christmas Experiences Castle Tours Archaeology Tours Rail Tours Street Art Tours Kayaking Tours Theme Parks Scavenger Hunts Music Tours Fashion Tours Crime Tours Religious Tours Underground Tours Climbing Helicopter Tours Classic Car Tours Multi-day Tours

Browse all things to do

Guides Store Tools

Menu

Destinations

Browse by region

Cambridge
Oxford
London
York
Bath
Windsor

Edinburgh
Glasgow
Aberdeen
Inverness
St Andrews
Stirling

Dublin
Galway
Cork
Limerick
Killarney
Kilkenny

Cardiff
Swansea
Newport
Llandudno
Conwy
Snowdonia

Northern Ireland

Belfast
Derry-Londonderry

Browse all destinations

Categories

Popular categories

Punting Walking Tours Food Tours Seasonal Events Ghost Tours Day Trips Bike Tours Museums Adventure Tours Hiking Tours Historical Tours Beer & Brewery Tours Cooking Classes Photography Tours Literary Tours Escape Rooms Nature and Wildlife Tours Harry Potter Tours Game Of Thrones Tours Architecture Tours Art Tours Family-friendly Shows Bus Tours Cruises & Sailing Sporting Events Nightlife Dining Experiences Classes & Workshops Seasonal Experiences Christmas Experiences Castle Tours Archaeology Tours Rail Tours Street Art Tours Kayaking Tours Theme Parks Scavenger Hunts Music Tours Fashion Tours Crime Tours Religious Tours Underground Tours Climbing Helicopter Tours Classic Car Tours Multi-day Tours

Browse all things to do

Guides Store Tools

…/
Home/
Store/
Travel Electronics/
Power Banks (Page 4)

Trailspot Store

Power Banks — Page 4

2421 products

Filter products

Brand

ACEXIERAFERIYAFMATAISVAPEANFLAGASNUGAZATOMAmazon BasicsAruatuAugustBAIJIALIBEAUTURALBEOSIORBLUETTIBXAXGXBearwindBeizknaBellannyBestwayBliMySweBoompodsByronCECOMBINECHICAMPERACOSLUSCTOCTOUCaldaraxCuteefunCutigicCutlairD.A.Y. RepublicDBPOWERDEKOPRODEWINNERDRIFWINDenabutyDewireaeyDfiupdnDracutumECO-WORTHYECVGHDEJXHKNFELZOEasyAccEcoLivzenEdasionEnergizerEppieBasicEujgoovFACHOIFEKTIKFLYLINKTECHFOSSiBOTFagalilFarobyFentonFenxyoFiadaFirexoFoyucoolFuitkeGLADFRESITGRIFEMAGVODEGenericGhzsteGuerayHANGSUNHAWK'S WORKHIONXMGAHOTUTHSLightingHailegeHandsiderHasihendyHazeldeneHewadHosguboHybrid MindsIAIGGICARER FAMILYIcan PRODUCTSJASOLYIJBLJIAQINGDAJJCJMLJODSONEJZFJackeryKALLORYKASIMOKEPLINKFUBUOKINGGOOKONCHILEKinYiLOKivdesKixolazrKouamorLALADEFIEELEIHMMYAOLITOHOMLOOFHIENLUCKDANOLZDICITARULeproLinkindLuqixceyLyaiLyytMERTTURMMGOMQLAEMQUPINMediAcousMeesMeekMiadyMiayicalMocelMuddy HandsMycketNAYAGOGONPLSEONbgrvBNebuLivaNinjaOBESTOFFCUPObelunrpOne FireOperitacxOpilroynOutsunnyPAIYULEPOPCHOSEPORUPAELPOSEIDONPOWEROWLPRUNUSPawflyPhimkePluto PackagingPongnasPowelephantQODOSENRINGRainbergRichVibeRonymeRosardenRoxicoslyRoyalswillRppiupRugoTechSAFIGLESHXMZSSIGBOTSLSMDSOQSYSSTAR-SPANGLEDSUBOOSSUNWERKSYLSTARSakerSavorluxeScstartxSeendaSendowtekSnugcoreSorbaySpirWoRchlanStaZamorSuolitaSurvival BoyzTEHAUXTILSWALLTOHETOTOUCHBeautyTRILINKTUXCAXITihooTriPoleTyenazaU+UUNEEDEUadmeUniclifeUomiantyVIMAZVOW VapersVTOMANVexNookVicloonWJTZDZWOLFBOXWSHuayeeWarmcoXHDATAYUEJIDZYUGSHNKFCYUNIBRIXYhenlovttYinhingYosoo Health GearZDMDRGBZORVICKZegoZestEchoZhajipaiZhouLinMouZonopycotsococozylaeSynicflintronicgaiatopi-boxiKuchelifeiYeHojojofunylaloohomelomitechlulirotuiaimqafsourcing map

Price

Pack size

11022033744756789

300 products

Sort by

Filters

Brand

ACEXIERAFERIYAFMATAISVAPEANFLAGASNUGAZATOMAmazon BasicsAruatuAugustBAIJIALIBEAUTURALBEOSIORBLUETTIBXAXGXBearwindBeizknaBellannyBestwayBliMySweBoompodsByronCECOMBINECHICAMPERACOSLUSCTOCTOUCaldaraxCuteefunCutigicCutlairD.A.Y. RepublicDBPOWERDEKOPRODEWINNERDRIFWINDenabutyDewireaeyDfiupdnDracutumECO-WORTHYECVGHDEJXHKNFELZOEasyAccEcoLivzenEdasionEnergizerEppieBasicEujgoovFACHOIFEKTIKFLYLINKTECHFOSSiBOTFagalilFarobyFentonFenxyoFiadaFirexoFoyucoolFuitkeGLADFRESITGRIFEMAGVODEGenericGhzsteGuerayHANGSUNHAWK'S WORKHIONXMGAHOTUTHSLightingHailegeHandsiderHasihendyHazeldeneHewadHosguboHybrid MindsIAIGGICARER FAMILYIcan PRODUCTSJASOLYIJBLJIAQINGDAJJCJMLJODSONEJZFJackeryKALLORYKASIMOKEPLINKFUBUOKINGGOOKONCHILEKinYiLOKivdesKixolazrKouamorLALADEFIEELEIHMMYAOLITOHOMLOOFHIENLUCKDANOLZDICITARULeproLinkindLuqixceyLyaiLyytMERTTURMMGOMQLAEMQUPINMediAcousMeesMeekMiadyMiayicalMocelMuddy HandsMycketNAYAGOGONPLSEONbgrvBNebuLivaNinjaOBESTOFFCUPObelunrpOne FireOperitacxOpilroynOutsunnyPAIYULEPOPCHOSEPORUPAELPOSEIDONPOWEROWLPRUNUSPawflyPhimkePluto PackagingPongnasPowelephantQODOSENRINGRainbergRichVibeRonymeRosardenRoxicoslyRoyalswillRppiupRugoTechSAFIGLESHXMZSSIGBOTSLSMDSOQSYSSTAR-SPANGLEDSUBOOSSUNWERKSYLSTARSakerSavorluxeScstartxSeendaSendowtekSnugcoreSorbaySpirWoRchlanStaZamorSuolitaSurvival BoyzTEHAUXTILSWALLTOHETOTOUCHBeautyTRILINKTUXCAXITihooTriPoleTyenazaU+UUNEEDEUadmeUniclifeUomiantyVIMAZVOW VapersVTOMANVexNookVicloonWJTZDZWOLFBOXWSHuayeeWarmcoXHDATAYUEJIDZYUGSHNKFCYUNIBRIXYhenlovttYinhingYosoo Health GearZDMDRGBZORVICKZegoZestEchoZhajipaiZhouLinMouZonopycotsococozylaeSynicflintronicgaiatopi-boxiKuchelifeiYeHojojofunylaloohomelomitechlulirotuiaimqafsourcing map

Price

Pack size

11022033744756789

Ninja Blast Max 570ml Portable Blender, 3 Functions, Lavender BC251EULD

Ninja Blast Max 570ml Portable Blender, 3 Functions, Lavender BC251EULD

Ninja£74.99Buy on AmazonPrice checked 12/10/2026

JODSONE Rechargeable Fast Curing U V Nail Lamp -Cordless Portable and Flexible Gooseneck for Gel Polish, Auto Sensor & 4 Timers Lavender Purple

JODSONE Rechargeable Fast Curing U V Nail Lamp -Cordless Portable and Flexible Gooseneck for Gel Polish, Auto Sensor & 4 Timers Lavender Purple

JODSONE£6.26Buy on AmazonPrice checked 12/10/2026

Simulation Burning Charcoal Light, Artificial LED Fireplace Lamp with Realistic Log, Flameless Fireplace Light for Indoors Living Room Decoration(Batteries Not Included)

Simulation Burning Charcoal Light, Artificial LED Fireplace Lamp with Realistic Log, Flameless Fireplace Light for Indoors Living Room Decoration(Batteries Not Included)

Obelunrp£13.79Buy on AmazonPrice checked 12/10/2026

Muddy Hands BBQ Fan Air Blower Fire Starter – Manual Charcoal BBQ Bellows Fan | Hand Powered Fire Starter for Barbecue, Grill, Fire Pit & Camping | Portable Outdoor BBQ Air Blower

Muddy Hands BBQ Fan Air Blower Fire Starter – Manual Charcoal BBQ Bellows Fan | Hand Powered Fire Starter for Barbecue, Grill, Fire Pit & Camping | Portable Outdoor BBQ Air Blower

Muddy Hands£8.49Buy on AmazonPrice checked 12/10/2026

Radiomaster Pocket ELRS Transmitter, Hall Gimbal Portable Mode2 (Charcoal)

Radiomaster Pocket ELRS Transmitter, Hall Gimbal Portable Mode2 (Charcoal)

HAWK'S WORK£95.99Buy on AmazonPrice checked 12/10/2026

Ghzste Flameless Fireplace, Fake Charcoal Night Light, Battery Operated Flame Lamp, Portable Tabletop Fire Light for Home Decor

Ghzste Flameless Fireplace, Fake Charcoal Night Light, Battery Operated Flame Lamp, Portable Tabletop Fire Light for Home Decor

Ghzste£12.39Buy on AmazonPrice checked 12/10/2026

Outsunny Portable Charcoal BBQ Grill w/Built-in Fan and Knob, Light Green

Outsunny Portable Charcoal BBQ Grill w/Built-in Fan and Knob, Light Green

Outsunny£39.99Buy on AmazonPrice checked 12/10/2026

GeekVape Sonder Q 2 Kit Beginner Friendly 1350mAh Built-In Battery 30W Max Output Adjustable Airflow Geek Vape No Nicotine (Fizzy Mint)

GeekVape Sonder Q 2 Kit Beginner Friendly 1350mAh Built-In Battery 30W Max Output Adjustable Airflow Geek Vape No Nicotine (Fizzy Mint)

VOW Vapers£8.99Buy on AmazonPrice checked 12/10/2026

HIONXMGA USB Rechargeable Book Light,2 Pack Eye Caring Reading Light Clip on Book, 3 Colours & Stepless Dimming, Portable & Flexible,Perfect for Booklovers and Kids-Mint+Light Lilac

HIONXMGA USB Rechargeable Book Light,2 Pack Eye Caring Reading Light Clip on Book, 3 Colours & Stepless Dimming, Portable & Flexible,Perfect for Booklovers and Kids-Mint+Light Lilac

HIONXMGA£11.89Buy on AmazonPrice checked 12/10/2026

JODSONE Fast Curing U V Nail Lamp - Portable and Flexible Gooseneck Lamp with 360° Adjustable Design, Rechargeable LED Dryer for Gel Polish, Auto Sensor & 4 Timers, Home DIY Manicure Light Mint Green

JODSONE Fast Curing U V Nail Lamp - Portable and Flexible Gooseneck Lamp with 360° Adjustable Design, Rechargeable LED Dryer for Gel Polish, Auto Sensor & 4 Timers, Home DIY Manicure Light Mint Green

JODSONE£5.99Buy on AmazonPrice checked 12/10/2026

HIONXMGA USB Rechargeable Book Light,Reading Light Clip on Book,3 Colours & Stepless Dimming,Portable & Flexible,Reading Lamp for Books in Bed at Night,Perfect for Booklovers and Kids,Mint

HIONXMGA USB Rechargeable Book Light,Reading Light Clip on Book,3 Colours & Stepless Dimming,Portable & Flexible,Reading Lamp for Books in Bed at Night,Perfect for Booklovers and Kids,Mint

HIONXMGA£6.99Buy on AmazonPrice checked 12/10/2026

Seenda Wireless Mouse, Silent with 2.4G USB Receiver, Mint-Purple Gradient

Seenda Wireless Mouse, Silent with 2.4G USB Receiver, Mint-Purple Gradient

Seenda£12.99Buy on AmazonPrice checked 12/10/2026

Show 288 more products

Lost-Mary 6k Rechargeable Pod System Device Kit - Compact Portable Electronic Device with Refillable Cartridge, USB-C Rechargeable Battery, Lightweight Pocket Design (Miamii Mint)

Lost-Mary 6k Rechargeable Pod System Device Kit - Compact Portable Electronic Device with Refillable Cartridge, USB-C Rechargeable Battery, Lightweight Pocket Design (Miamii Mint)

Generic£14.99Buy on AmazonPrice checked 12/10/2026

VAPORESSO XROS 5 [Coral Red] Vape Pod Kit, Refillable 2ml, No Nicotine

VAPORESSO XROS 5 [Coral Red] Vape Pod Kit, Refillable 2ml, No Nicotine

Zego£19.99Buy on AmazonPrice checked 12/10/2026

TUXCAXI Neon Sign Fuckoff For Man Cave With Battery USB,coral pink

TUXCAXI Neon Sign Fuckoff For Man Cave With Battery USB,coral pink

TUXCAXI£15.49Buy on AmazonPrice checked 12/10/2026

Vaporesso Xros 5 Vape Kits (Coral Red) - 30w, 1500mAh Battery & 3A Super Charging - Adjustable Airflow, 0.88" HD Screen, Corex 3.0 Tech - Compatible with Vaporesso Xros Pod - No Nicotine Vape

Vaporesso Xros 5 Vape Kits (Coral Red) - 30w, 1500mAh Battery & 3A Super Charging - Adjustable Airflow, 0.88" HD Screen, Corex 3.0 Tech - Compatible with Vaporesso Xros Pod - No Nicotine Vape

Hewad£18.99Buy on AmazonPrice checked 12/10/2026

Oxva NeXLIM Vape Kit [Coral Orange] - No Nicotine

Oxva NeXLIM Vape Kit [Coral Orange] - No Nicotine

Survival Boyz£24.99Buy on AmazonPrice checked 12/10/2026

Boompods Zero Mini Bluetooth Speaker - Small Portable Speakers, Coral

Boompods Zero Mini Bluetooth Speaker - Small Portable Speakers, Coral

Boompods£24.99Buy on AmazonPrice checked 12/10/2026

Cordless Lithium Battery Portable Car Washing Machine, Turquoise

Cordless Lithium Battery Portable Car Washing Machine, Turquoise

Generic£398.00Buy on AmazonPrice checked 12/10/2026

qaf Wireless Mouse 2.4G, Small Compact USB Mouse with Nano Receiver, Quiet Click, 1600 DPI, AA Battery Mouse, Portable Travel Mouse for Laptop, PC and Mac with USB-A

qaf Wireless Mouse 2.4G, Small Compact USB Mouse with Nano Receiver, Quiet Click, 1600 DPI, AA Battery Mouse, Portable Travel Mouse for Laptop, PC and Mac with USB-A

qaf£10.99Buy on AmazonPrice checked 12/10/2026

AA Battery Storage Box Space-Saving Compact Protective Stackable Portable

AA Battery Storage Box Space-Saving Compact Protective Stackable Portable

Generic£2.19Buy on AmazonPrice checked 12/10/2026

10PCS Hard Plastic Batteries Storage Boxes,AA/AAA Cell Battery Storage Cases,Multifunctional Plastic Battery Case Holder for Storing and Protecting AA and AAA Batteries,Clear Color

10PCS Hard Plastic Batteries Storage Boxes,AA/AAA Cell Battery Storage Cases,Multifunctional Plastic Battery Case Holder for Storing and Protecting AA and AAA Batteries,Clear Color

Miayical£4.99Buy on AmazonPrice checked 12/10/2026

jojofuny Aaa Battery Case and Holder 2-slot Hard Plastic Storage Box for Portable Battery Organization and Protection

jojofuny Aaa Battery Case and Holder 2-slot Hard Plastic Storage Box for Portable Battery Organization and Protection

jojofuny£4.09Buy on AmazonPrice checked 12/10/2026

AA Battery Storage Box Space-Saving Compact Protective Stackable Portable

AA Battery Storage Box Space-Saving Compact Protective Stackable Portable

Generic£1.27Buy on AmazonPrice checked 12/10/2026

U+U 2 Pack Camping Lanterns, Portable Camping Lights Battery Powered, Collapsible Camping Lanterns, Camping Lamp for Outdoor Emergency Tent, Black

U+U 2 Pack Camping Lanterns, Portable Camping Lights Battery Powered, Collapsible Camping Lanterns, Camping Lamp for Outdoor Emergency Tent, Black

U+U£9.99Buy on AmazonPrice checked 12/10/2026

AFERIY 2048Wh Expandable Battery Compatible with P280, One P280 Support Up to 4 Extra Batteries (Not for Standalone Use)

AFERIY 2048Wh Expandable Battery Compatible with P280, One P280 Support Up to 4 Extra Batteries (Not for Standalone Use)

AFERIY£599.05Buy on AmazonPrice checked 12/10/2026

AFERIY P280 Portable Power Station 2800W, 2048Wh LFP Battery Expandable to 10.24kWh,1.5H Fast Charging, 2x140W USB-C Output, 220V-240V, Solar Generator for Camping, Home,Off-grid, 7-Year Warranty

AFERIY P280 Portable Power Station 2800W, 2048Wh LFP Battery Expandable to 10.24kWh,1.5H Fast Charging, 2x140W USB-C Output, 220V-240V, Solar Generator for Camping, Home,Off-grid, 7-Year Warranty

AFERIY£841.09Buy on AmazonPrice checked 12/10/2026

AFERIY P300 Portable Power Station 3000W, 2048Wh LFP Battery Expandable to 10.24kWh,1.5H Fast Charging, 2x140W USB-C Output, 220V-240V, Solar Generator for Camping, Home,Off-grid, 7-Year Warranty

AFERIY P300 Portable Power Station 3000W, 2048Wh LFP Battery Expandable to 10.24kWh,1.5H Fast Charging, 2x140W USB-C Output, 220V-240V, Solar Generator for Camping, Home,Off-grid, 7-Year Warranty

AFERIY£893.79Buy on AmazonPrice checked 12/10/2026

Sendowtek Electric Insulin Cooler Cup Battery Powered

Sendowtek Electric Insulin Cooler Cup Battery Powered

Sendowtek£64.99Buy on AmazonPrice checked 12/10/2026

Ronyme E Bike Battery Box Lock Anti-theft Lock Sturdy Waterproof Lightweight with 2 Keys Multiuse for Electrombile E Bike Supplies

Ronyme E Bike Battery Box Lock Anti-theft Lock Sturdy Waterproof Lightweight with 2 Keys Multiuse for Electrombile E Bike Supplies

Ronyme£4.83Buy on AmazonPrice checked 12/10/2026

Rv Battery Lock, Anti-Theft Metal Safety Portable Ebike Key Ignition Rv Battery Box Lock with 2 Keys

Rv Battery Lock, Anti-Theft Metal Safety Portable Ebike Key Ignition Rv Battery Box Lock with 2 Keys

Faroby£5.19Buy on AmazonPrice checked 12/10/2026

Portable Door Lock with 120dB Alarm, Heavy Duty Adjustable Door Jammer Stopper and Security Brace for Travel, Hotel and Home Apartment Use（Battery Not Included）

Portable Door Lock with 120dB Alarm, Heavy Duty Adjustable Door Jammer Stopper and Security Brace for Travel, Hotel and Home Apartment Use（Battery Not Included）

LEIHMMYAO£5.86Buy on AmazonPrice checked 12/10/2026

RV Battery Lock, Anti-theft Metal Safety Portable Ebike Key Ignition RV Battery Box Lock with 2 Keys for Motorcycle Electric Bike Scooter

RV Battery Lock, Anti-theft Metal Safety Portable Ebike Key Ignition RV Battery Box Lock with 2 Keys for Motorcycle Electric Bike Scooter

Faroby£5.08Buy on AmazonPrice checked 12/10/2026

Aisvape NIU PRO Vaporiser | Herbal Heating Quick Swapped Chamber | 160℃-226℃ Portable Dry Herb Vaporizer| Replaceable SUS304 Pods| 1400 mAh Battery | Haptic Feedback(Sliver)

Aisvape NIU PRO Vaporiser | Herbal Heating Quick Swapped Chamber | 160℃-226℃ Portable Dry Herb Vaporizer| Replaceable SUS304 Pods| 1400 mAh Battery | Haptic Feedback(Sliver)

AISVAPE£34.04Buy on AmazonPrice checked 12/10/2026

Dry Vaporizer with Isolated Air Path,2200mah Huge Battery,5S Quick Heat,Patented Cooling System-Honeycomb Briquet,3D Suitcase Shape（No Nicotine） (Silver)

Dry Vaporizer with Isolated Air Path,2200mah Huge Battery,5S Quick Heat,Patented Cooling System-Honeycomb Briquet,3D Suitcase Shape（No Nicotine） (Silver)

MGO£37.99Buy on AmazonPrice checked 12/10/2026

AISVAPE NIU-PRO Dry Herb Vaporiser | Quick Swap Chamber | Precise Temps Control |160℃-226℃ | OLED Display | Nicotine Free | Portable Vaporizer for Herb | 1400mAh Battery

AISVAPE NIU-PRO Dry Herb Vaporiser | Quick Swap Chamber | Precise Temps Control |160℃-226℃ | OLED Display | Nicotine Free | Portable Vaporizer for Herb | 1400mAh Battery

AISVAPE£45.90Buy on AmazonPrice checked 12/10/2026

Cordless USB-Rechargeable Electric Eyebrow Trimmer for Women & Men – Painless Wet/Dry Facial Hair Remover with Cutting Head Portable Brows Upper Lip

Cordless USB-Rechargeable Electric Eyebrow Trimmer for Women & Men – Painless Wet/Dry Facial Hair Remover with Cutting Head Portable Brows Upper Lip

Pongnas£5.51Buy on AmazonPrice checked 12/10/2026

Lady Shavers for Women, 2-in-1 Painless Bikini Trimmer Women & Facial Hair Remover, Wet/Dry Rechargeable Electric Razor with Battery Indicator, Portable for Face, Underarm, Legs & Pubic Hair, Pink

Lady Shavers for Women, 2-in-1 Painless Bikini Trimmer Women & Facial Hair Remover, Wet/Dry Rechargeable Electric Razor with Battery Indicator, Portable for Face, Underarm, Legs & Pubic Hair, Pink

Cutlair£19.99Buy on AmazonPrice checked 12/10/2026

LED Battery-Powered Wireless Night Light Tap Touch Lamp, Self Adhesive Push Button for Closets, Cabinets, Counters, or Utility Rooms, Cordless Puck Shape, Batteries Not Included (2 Pack Push Lights)

LED Battery-Powered Wireless Night Light Tap Touch Lamp, Self Adhesive Push Button for Closets, Cabinets, Counters, or Utility Rooms, Cordless Puck Shape, Batteries Not Included (2 Pack Push Lights)

D.A.Y. Republic£4.99Buy on AmazonPrice checked 12/10/2026

Edasion 20W LED Rechargeable Work Light 3000LM Portable Battery Floodlight

Edasion 20W LED Rechargeable Work Light 3000LM Portable Battery Floodlight

Edasion£23.98Buy on AmazonPrice checked 12/10/2026

KINGGOO Portable Folding LED Table Lamp Desk Light Sensitive Touch Control 3 Levels Adjustable Brightness Dimmable USB Charging Port 4 * AA Batteries Powered.

KINGGOO Portable Folding LED Table Lamp Desk Light Sensitive Touch Control 3 Levels Adjustable Brightness Dimmable USB Charging Port 4 * AA Batteries Powered.

KINGGOO£9.99Buy on AmazonPrice checked 12/10/2026

Miady 2 Pack Ultra Slim Magnetic Wireless Portable Charger 5000mAh

Miady 2 Pack Ultra Slim Magnetic Wireless Portable Charger 5000mAh

Miady£20.39Buy on AmazonPrice checked 12/10/2026

Phimke Portable Handheld Fan, High Speed Turbo Hand Held Fan with Speed (1-199) 4000mAh Battery Up to 16hrs, Rechargeable Mini Hand Fan with LED Display, Foldable Portable Fan for Home Outdoor (Black)

Phimke Portable Handheld Fan, High Speed Turbo Hand Held Fan with Speed (1-199) 4000mAh Battery Up to 16hrs, Rechargeable Mini Hand Fan with LED Display, Foldable Portable Fan for Home Outdoor (Black)

Phimke£10.99Buy on AmazonPrice checked 12/10/2026

Pawfly Aquarium Air Pump 2.5 L/min Battery Powered Oxygen Pump for 20-120 L Fish Tanks Buckets Portable Silent Aerator Pump for Outdoor Fishing, Power Outage and Fish Transportation

Pawfly Aquarium Air Pump 2.5 L/min Battery Powered Oxygen Pump for 20-120 L Fish Tanks Buckets Portable Silent Aerator Pump for Outdoor Fishing, Power Outage and Fish Transportation

Pawfly£12.99Buy on AmazonPrice checked 12/10/2026

Storage Box Case for DJI Neo 2 3D Printed Protective Carrying Case, Anti-Pressure Hard Case with Magnetic Lid and 2 Battery Compartments Portable for NEO2 Drone Protection Accessories

Storage Box Case for DJI Neo 2 3D Printed Protective Carrying Case, Anti-Pressure Hard Case with Magnetic Lid and 2 Battery Compartments Portable for NEO2 Drone Protection Accessories

Generic£24.99Buy on AmazonPrice checked 12/10/2026

otuiaim Portable Tool Storage, Carrying Case Bag for Batteries & Chargers

otuiaim Portable Tool Storage, Carrying Case Bag for Batteries & Chargers

otuiaim£35.99Buy on AmazonPrice checked 12/10/2026

Tyre Inflator Air Compressor, Portable Cordless Car Bike Tyre Pump, 150PSI

Tyre Inflator Air Compressor, Portable Cordless Car Bike Tyre Pump, 150PSI

ASNUG£19.99Buy on AmazonPrice checked 12/10/2026

Portable Radio Small, AM/FM/SW Battery Radio Pocket with Excellent Reception and Headphone Jack, Mini Compact Walkman for Outdoor, Indoor & Emergencies

Portable Radio Small, AM/FM/SW Battery Radio Pocket with Excellent Reception and Headphone Jack, Mini Compact Walkman for Outdoor, Indoor & Emergencies

BliMySwe£6.88Buy on AmazonPrice checked 12/10/2026

Pocket Mini Radio, Portable AM FM Worldband Radio with Best Reception

Pocket Mini Radio, Portable AM FM Worldband Radio with Best Reception

LOOFHIEN£6.99Buy on AmazonPrice checked 12/10/2026

PRUNUS J-166 Portable Radio AM FM, Battery Operated Radio

PRUNUS J-166 Portable Radio AM FM, Battery Operated Radio

PRUNUS£10.99Buy on AmazonPrice checked 12/10/2026

iCAN iFold Lightwight Electric Wheelchair Y-12, Folding, 20kg lightweight, Removable 10Ah Lithium Battery, 11 miles Range, 120kg capacity, Aluminium Powerchair Portable for Travel & Airplane Approved.

iCAN iFold Lightwight Electric Wheelchair Y-12, Folding, 20kg lightweight, Removable 10Ah Lithium Battery, 11 miles Range, 120kg capacity, Aluminium Powerchair Portable for Travel & Airplane Approved.

Ican PRODUCTS£449.99Buy on AmazonPrice checked 12/10/2026

Fenton FT15LED MK2 15-Inch Portable PA System, 800W, Battery, Mic

Fenton FT15LED MK2 15-Inch Portable PA System, 800W, Battery, Mic

Fenton£159.95Buy on AmazonPrice checked 12/10/2026

Cozyla Tablet TV: 32" Smart Portable TV on Wheels 1080P Touchscreen Monitor

Cozyla Tablet TV: 32" Smart Portable TV on Wheels 1080P Touchscreen Monitor

cozyla£934.99Buy on AmazonPrice checked 12/10/2026

PRUNUS J-328 Small Radio Portable Rechargeable FM Radio,MP3 Radio

PRUNUS J-328 Small Radio Portable Rechargeable FM Radio,MP3 Radio

PRUNUS£17.99Buy on AmazonPrice checked 12/10/2026

Mini Chainsaw Cordless 6-Inch Handheld Small Chain Saw with 2X Battery, Blue 21V Battery Powered Portable Electric Mini Chainsaw with Safety Lock for Courtyard Garden Household Tree Branch Trimming

Mini Chainsaw Cordless 6-Inch Handheld Small Chain Saw with 2X Battery, Blue 21V Battery Powered Portable Electric Mini Chainsaw with Safety Lock for Courtyard Garden Household Tree Branch Trimming

Royalswill£14.09Buy on AmazonPrice checked 12/10/2026

Electric Bike Battery Case Power Lock with 2 Keys,Anti Theft Safety Locks Ebike Cylinder Lock,Compatible with Motorcycle Electric Bike Scooter E-Bike

Electric Bike Battery Case Power Lock with 2 Keys,Anti Theft Safety Locks Ebike Cylinder Lock,Compatible with Motorcycle Electric Bike Scooter E-Bike

JASOLYI£7.18Buy on AmazonPrice checked 12/10/2026

Lyyt Portable LED Pull Light with Adjustable Cord, Ideal for Indoor and Sheltered Outdoor Use, Battery-Powered with Super Bright 60 Lumens Output Cool White

Lyyt Portable LED Pull Light with Adjustable Cord, Ideal for Indoor and Sheltered Outdoor Use, Battery-Powered with Super Bright 60 Lumens Output Cool White

Lyyt£5.98Buy on AmazonPrice checked 12/10/2026

Cordless Pressure Washer,21V Portable Power Washer with 2 * 2.0Ah Batteries

Cordless Pressure Washer,21V Portable Power Washer with 2 * 2.0Ah Batteries

JIAQINGDA£29.99Buy on AmazonPrice checked 12/10/2026

21V 35bar-High Pressure Cordless Pressure Washer, 6-in-1 Adjustable Nozzle, 240L/h Portable Pressure Washer with Battery, 5m Hose, for Car Floor Garden Cleaning Watering (B-2 batteries)

21V 35bar-High Pressure Cordless Pressure Washer, 6-in-1 Adjustable Nozzle, 240L/h Portable Pressure Washer with Battery, 5m Hose, for Car Floor Garden Cleaning Watering (B-2 batteries)

Kouamor£9.99Buy on AmazonPrice checked 12/10/2026

Rainberg Rechargeable Hand held Fan with LED Display, 5-Speed Settings, 5000mAh Battery, 90-Degree Adjustable, Desk Fan, Hand Fan, Portable fan, Quiet Cooling, Compact Design, USB Charging (White)

Rainberg Rechargeable Hand held Fan with LED Display, 5-Speed Settings, 5000mAh Battery, 90-Degree Adjustable, Desk Fan, Hand Fan, Portable fan, Quiet Cooling, Compact Design, USB Charging (White)

Rainberg£10.99Buy on AmazonPrice checked 12/10/2026

Saker Portable Camping Light with Stand 20000mAh 73.2" Work Light LD18

Saker Portable Camping Light with Stand 20000mAh 73.2" Work Light LD18

Saker£74.98Buy on AmazonPrice checked 12/10/2026

1500W Cordless Pressure Washer,21V Portable Pressure Washer,870 Psi High Power Washer Kit with 2 Nozzles 2000mAh Battery 16.4FT Hose Pressure Car Washers for Car Frool Garden Outdoor with bucket

1500W Cordless Pressure Washer,21V Portable Pressure Washer,870 Psi High Power Washer Kit with 2 Nozzles 2000mAh Battery 16.4FT Hose Pressure Car Washers for Car Frool Garden Outdoor with bucket

RugoTech£25.99Buy on AmazonPrice checked 12/10/2026

Rechargeable Hand Warmers 2 Pack, Magnetic USB Electric 5000mAh, Pocket Size, 3 Heat Levels, 8 Hours Battery Life, Portable Reusable, Ideal for Outdoor, Christmas

Rechargeable Hand Warmers 2 Pack, Magnetic USB Electric 5000mAh, Pocket Size, 3 Heat Levels, 8 Hours Battery Life, Portable Reusable, Ideal for Outdoor, Christmas

ICARER FAMILY£19.99Buy on AmazonPrice checked 12/10/2026

Handheld Vacuum Cleaner Cordless, 50000PA Powerful Car Hoover with Suction & Blow Function – Dual Battery (24 Mins Runtime) Ultra-long Battery Life,Lightweight & Portable Car Cleaner for Car/Home/Pet

Handheld Vacuum Cleaner Cordless, 50000PA Powerful Car Hoover with Suction & Blow Function – Dual Battery (24 Mins Runtime) Ultra-long Battery Life,Lightweight & Portable Car Cleaner for Car/Home/Pet

Cutigic£49.99Buy on AmazonPrice checked 12/10/2026

Uadme Food Vacuum Sealer, Handheld Automatic with Battery

Uadme Food Vacuum Sealer, Handheld Automatic with Battery

Uadme£9.99Buy on AmazonPrice checked 12/10/2026

Mycket DAB/DAB+ Digital & FM Radio, USB Rechargeable and 2200mAh Battery Powered Radio,Portable DAB Radio, Radio with Bluetooth/U Disk, 80 Preset Stations,Headphone Jack, LED Display, for Home,Travel

Mycket DAB/DAB+ Digital & FM Radio, USB Rechargeable and 2200mAh Battery Powered Radio,Portable DAB Radio, Radio with Bluetooth/U Disk, 80 Preset Stations,Headphone Jack, LED Display, for Home,Travel

Mycket£33.99Buy on AmazonPrice checked 12/10/2026

Hybrid Minds™ Rechargeable Work Light, 2 Pack Portable LED Floodlights

Hybrid Minds™ Rechargeable Work Light, 2 Pack Portable LED Floodlights

Hybrid Minds£16.49Buy on AmazonPrice checked 12/10/2026

Roxicosly DAB Radio Portable with Bluetooth, 3000mAh Rechargeable Battery

Roxicosly DAB Radio Portable with Bluetooth, 3000mAh Rechargeable Battery

Roxicosly£27.96Buy on AmazonPrice checked 12/10/2026

One Fire Rechargeable lamp, Portable Light, Reading Light,Long Battery Life

One Fire Rechargeable lamp, Portable Light, Reading Light,Long Battery Life

One Fire£18.99Buy on AmazonPrice checked 12/10/2026

AAA Rechargeable Batteries Lithium 8 Pack with Fast Charger - 1300mWh High Capacity 1.5V Constant Output Rechargeable AAA Batteries, 2000 Cycles Long-Lasting Li-ion Triple a Batteries

AAA Rechargeable Batteries Lithium 8 Pack with Fast Charger - 1300mWh High Capacity 1.5V Constant Output Rechargeable AAA Batteries, 2000 Cycles Long-Lasting Li-ion Triple a Batteries

Dracutum£22.99Buy on AmazonPrice checked 12/10/2026

Snugcore Handheld Fan Portable Foldable Mini Fan 5 Speeds Rechargeable 1200mAh Battery 90° Adjustable Hand Held Fans, Small Personal Cooling Fans Ultra Quite for Travel Desk Use Dark Black

Snugcore Handheld Fan Portable Foldable Mini Fan 5 Speeds Rechargeable 1200mAh Battery 90° Adjustable Hand Held Fans, Small Personal Cooling Fans Ultra Quite for Travel Desk Use Dark Black

Snugcore£5.99Buy on AmazonPrice checked 12/10/2026

Car Jump Starter, FLYLINKTECH 5000A 12V Portable Car Battery Booster Jump Starter Power Pack (up to 9.0L Petrol Or 8.5L Diesel Engine), Power Bank with LED Flashlight, IP67

Car Jump Starter, FLYLINKTECH 5000A 12V Portable Car Battery Booster Jump Starter Power Pack (up to 9.0L Petrol Or 8.5L Diesel Engine), Power Bank with LED Flashlight, IP67

FLYLINKTECH£39.99Buy on AmazonPrice checked 12/10/2026

ECVGHD Multipacks of 5/10 CR2025 3V Coin Battery, 10 pieces

ECVGHD Multipacks of 5/10 CR2025 3V Coin Battery, 10 pieces

ECVGHD£5.79Buy on AmazonPrice checked 12/10/2026

Aruatu 12 Pack Wedding Mini Portable Fan for Guests (No battery included)

Aruatu 12 Pack Wedding Mini Portable Fan for Guests (No battery included)

Aruatu£34.99Buy on AmazonPrice checked 12/10/2026

Power Bank, Fast 22.5W Charging 10000mAh Portable Charger, Small Battery Pack USB C Input & Output Powerbank with LED Display, PD3.0 QC4.0 Phone Battery Pack for iPhone 17/16/15/14/13, Android etc.

Power Bank, Fast 22.5W Charging 10000mAh Portable Charger, Small Battery Pack USB C Input & Output Powerbank with LED Display, PD3.0 QC4.0 Phone Battery Pack for iPhone 17/16/15/14/13, Android etc.

Hosgubo£11.99Buy on AmazonPrice checked 12/10/2026

6 Pack Push Lights, Stick On Lights Touch LED, Battery Powered Tap Lights

6 Pack Push Lights, Stick On Lights Touch LED, Battery Powered Tap Lights

Dfiupdn£8.59Buy on AmazonPrice checked 12/10/2026

ZDMDRGB 6Pack 4ft Portable 5000mAh Battery Powered RGB Tube Light with Case Handheld Color Neon Lights Bar Stand for LED Video Studio Light Stick Photography DJ Dance Party Stage Photo Booth Lighting

ZDMDRGB 6Pack 4ft Portable 5000mAh Battery Powered RGB Tube Light with Case Handheld Color Neon Lights Bar Stand for LED Video Studio Light Stick Photography DJ Dance Party Stage Photo Booth Lighting

ZDMDRGB£250.89Buy on AmazonPrice checked 12/10/2026

6 Pack Wireless Stick On Push Lights, Battery Powered Touch Lamp with 4 LED

6 Pack Wireless Stick On Push Lights, Battery Powered Touch Lamp with 4 LED

Lyai£7.99Buy on AmazonPrice checked 12/10/2026

6 Pack Portable Stick on Wall Lights, Touch Control Battery Powered Push Lights, 70 Lumen Stick on Wireless LED Cabinet Light for Kitchen Closets Armoire Cabinets Counters Utility Room[Energy Class A]

6 Pack Portable Stick on Wall Lights, Touch Control Battery Powered Push Lights, 70 Lumen Stick on Wireless LED Cabinet Light for Kitchen Closets Armoire Cabinets Counters Utility Room[Energy Class A]

CECOMBINE£8.29Buy on AmazonPrice checked 12/10/2026

6 Pack LED Pull Cord Light Bulb, Battery Operated, Portable Hanging Pull Cord Lamp, for Wedding, Festival, Outdoor, Camping, Garden Parties, Decoration(Cold White)

6 Pack LED Pull Cord Light Bulb, Battery Operated, Portable Hanging Pull Cord Lamp, for Wedding, Festival, Outdoor, Camping, Garden Parties, Decoration(Cold White)

Caldarax£13.99Buy on AmazonPrice checked 12/10/2026

CTOCTOU 6 Pack Portable Battery Operated Wall Lights, Push Lights Battery Powered Stick on Lights for Under Cupboards, Closets, Cabinets, Counters, Wardrobe, Kitchen Lights

CTOCTOU 6 Pack Portable Battery Operated Wall Lights, Push Lights Battery Powered Stick on Lights for Under Cupboards, Closets, Cabinets, Counters, Wardrobe, Kitchen Lights

CTOCTOU£9.99Buy on AmazonPrice checked 12/10/2026

Uniclife 5 Pack LED Keychain Flashlight 5 Colors of Shells | Mini LED Keychain Light 12 Lumen Portable Ultra Bright Battery Powered Key Ring Torch for Outdoor Camping Hiking and Emergency Lighting

Uniclife 5 Pack LED Keychain Flashlight 5 Colors of Shells | Mini LED Keychain Light 12 Lumen Portable Ultra Bright Battery Powered Key Ring Torch for Outdoor Camping Hiking and Emergency Lighting

Uniclife£6.99Buy on AmazonPrice checked 12/10/2026

STAR-SPANGLED Tap Light Push Lights, Stick on LED Touch Puck Light AAA Battery Operated, Press Spot Lighting Indoor for Under Cupboard, Wardrobe, Cabinet, Kitchen (2.8inch, Silver, Cool White, 5 Pack)

STAR-SPANGLED Tap Light Push Lights, Stick on LED Touch Puck Light AAA Battery Operated, Press Spot Lighting Indoor for Under Cupboard, Wardrobe, Cabinet, Kitchen (2.8inch, Silver, Cool White, 5 Pack)

STAR-SPANGLED£9.99Buy on AmazonPrice checked 12/10/2026

STAR-SPANGLED 2.8” Stick on LED Puck Lights AAA Battery, 5 Pack Golden Warm

STAR-SPANGLED 2.8” Stick on LED Puck Lights AAA Battery, 5 Pack Golden Warm

STAR-SPANGLED£9.99Buy on AmazonPrice checked 12/10/2026

STAR-SPANGLED 2.8” Stick on Puck Lights AAA Battery Operated, 5 Pack White

STAR-SPANGLED 2.8” Stick on Puck Lights AAA Battery Operated, 5 Pack White

STAR-SPANGLED£9.99Buy on AmazonPrice checked 12/10/2026

STAR-SPANGLED 2.8” Stick on Puck Lights AAA Battery Operated, 5 Pack Warm

STAR-SPANGLED 2.8” Stick on Puck Lights AAA Battery Operated, 5 Pack Warm

STAR-SPANGLED£9.99Buy on AmazonPrice checked 12/10/2026

Hazeldene Stick On Lights 5 Pack, Battery Lights Indoor, Portable Light, Battery LED Puck Light for Indoor Use [Energy Class A]

Hazeldene Stick On Lights 5 Pack, Battery Lights Indoor, Portable Light, Battery LED Puck Light for Indoor Use [Energy Class A]

Hazeldene£6.07Buy on AmazonPrice checked 12/10/2026

POWEROWL NI-MH AAA Rechargeable Battery 1.2V 1000mah 4-Pack AAA Rechargeable Batteries for Cordless Phones

POWEROWL NI-MH AAA Rechargeable Battery 1.2V 1000mah 4-Pack AAA Rechargeable Batteries for Cordless Phones

POWEROWL£3.99Buy on AmazonPrice checked 12/10/2026

Energizer Recharge Universal Rechargeable AA Batteries (4 Pack) 1300 mAh

Energizer Recharge Universal Rechargeable AA Batteries (4 Pack) 1300 mAh

Energizer£5.99Buy on AmazonPrice checked 12/10/2026

Fiada 20 Set Mini Portable Handheld Fans Bulk, Battery Operated

Fiada 20 Set Mini Portable Handheld Fans Bulk, Battery Operated

Fiada£32.49Buy on AmazonPrice checked 12/10/2026

Tilswall Cordless Hot Glue Gun, W106s, Fast Preheating with 2Ah Battery

Tilswall Cordless Hot Glue Gun, W106s, Fast Preheating with 2Ah Battery

TILSWALL£14.24Buy on AmazonPrice checked 12/10/2026

Cordless Drill：DEKOPRO 12V Power Battery Drill Set with Small Electric Drills and 3/8-inch Keyless Chuck with Portable Tool Set Gift Box (Pink)

Cordless Drill：DEKOPRO 12V Power Battery Drill Set with Small Electric Drills and 3/8-inch Keyless Chuck with Portable Tool Set Gift Box (Pink)

DEKOPRO£24.99Buy on AmazonPrice checked 12/10/2026

cotsoco Mini Massage Gun Deep Tissue,6 Speeds Cordless Handheld Muscle Massager with 4 Heads 1800mAh Battery & Type-C Charging, Super Quiet Chargeable Device Pain Relief, Best Gift

cotsoco Mini Massage Gun Deep Tissue,6 Speeds Cordless Handheld Muscle Massager with 4 Heads 1800mAh Battery & Type-C Charging, Super Quiet Chargeable Device Pain Relief, Best Gift

cotsoco£13.99Buy on AmazonPrice checked 12/10/2026

Car Battery Jump Starter, Portable Power Battery Pack 2000A Peak Jump Box for Motorcycle Up to 7L Gas & 4L Diesel 3 Modes Flashlight and Safety Jumper Clamps

Car Battery Jump Starter, Portable Power Battery Pack 2000A Peak Jump Box for Motorcycle Up to 7L Gas & 4L Diesel 3 Modes Flashlight and Safety Jumper Clamps

Scstartx£25.49Buy on AmazonPrice checked 12/10/2026

SUBOOS Camping Lanterns Battery Operated [2 Pack] - 2X Brighter LED Camping Light Lamp with Magnetic Base and Foldable Hook for Hanging, Portable for Hurricane, Emergency, Home, Shed and More

SUBOOS Camping Lanterns Battery Operated [2 Pack] - 2X Brighter LED Camping Light Lamp with Magnetic Base and Foldable Hook for Hanging, Portable for Hurricane, Emergency, Home, Shed and More

SUBOOS£11.89Buy on AmazonPrice checked 12/10/2026

DEKOPRO 12V Cordless Drill 1.65lbs Lightweight, Variable Speed Type-C Charging Battery Powered Electric Screwdriver, 3/8" Chuck Drill Kit for Women with Portable DIY Tool Set

DEKOPRO 12V Cordless Drill 1.65lbs Lightweight, Variable Speed Type-C Charging Battery Powered Electric Screwdriver, 3/8" Chuck Drill Kit for Women with Portable DIY Tool Set

DEKOPRO£21.84Buy on AmazonPrice checked 12/10/2026

Byron Wireless Portable Doorbell Set – 150 m Range – 16 Melodies – DBY-22351BS

Byron Wireless Portable Doorbell Set – 150 m Range – 16 Melodies – DBY-22351BS

Byron£8.99Buy on AmazonPrice checked 12/10/2026

Electric Drill Screwdriver, 49 in 1 Portable Cordless Screwdriver Set Rotated 90 Degrees Electric Screwdrivers Cordless Handle with Led Worklight and Charger for Home Office DIY Tools

Electric Drill Screwdriver, 49 in 1 Portable Cordless Screwdriver Set Rotated 90 Degrees Electric Screwdrivers Cordless Handle with Led Worklight and Charger for Home Office DIY Tools

MQUPIN£12.35Buy on AmazonPrice checked 12/10/2026

Byron Wireless Doorbell Set – Twin Pack – Battery Portable and Plug in – 150 m Range – 16 Melodies – Black – DBY-22354BS

Byron Wireless Doorbell Set – Twin Pack – Battery Portable and Plug in – 150 m Range – 16 Melodies – Black – DBY-22354BS

Byron£14.99Buy on AmazonPrice checked 12/10/2026

Byron Wireless Portable Doorbell Set - 150 m Range - 16 Melodies - DBY-22311

Byron Wireless Portable Doorbell Set - 150 m Range - 16 Melodies - DBY-22311

Byron£11.00Buy on AmazonPrice checked 12/10/2026

Byron Wireless Doorbell Set, Portable Battery-powered Chime & Plug-In Chime, 150m Range in open field, 16 Melodies, DBY-22314UK

Byron Wireless Doorbell Set, Portable Battery-powered Chime & Plug-In Chime, 150m Range in open field, 16 Melodies, DBY-22314UK

Byron£15.99Buy on AmazonPrice checked 12/10/2026

ZORVICK 10000mAh Battery Electric Insulin Cooler Travel Case 4 Cooling Mode

ZORVICK 10000mAh Battery Electric Insulin Cooler Travel Case 4 Cooling Mode

ZORVICK£119.99Buy on AmazonPrice checked 12/10/2026

PAIYULE 140 Battery Organiser Storage Case with BT168 Tester Black

PAIYULE 140 Battery Organiser Storage Case with BT168 Tester Black

PAIYULE£17.99Buy on AmazonPrice checked 12/10/2026

1 Pcs Battery Case Box with USB Port, 3 X AA Battery Power Bank, Battery Holder Case with On/Off Switch Cover for 4.5V LED Strip Lights, Fairy String Lights and Christmas Decorations (White)

1 Pcs Battery Case Box with USB Port, 3 X AA Battery Power Bank, Battery Holder Case with On/Off Switch Cover for 4.5V LED Strip Lights, Fairy String Lights and Christmas Decorations (White)

ZhouLinMou£3.89Buy on AmazonPrice checked 12/10/2026

Hailege 5pcs 18650 Battery Case Portable Black USB Power Bank Power Charger Pack Box for 1x18650 Battery

Hailege 5pcs 18650 Battery Case Portable Black USB Power Bank Power Charger Pack Box for 1x18650 Battery

Hailege£9.99Buy on AmazonPrice checked 12/10/2026

JJC 28-Slot AA Battery Storage Case Water-Resistant Hard Holder with Tester

JJC 28-Slot AA Battery Storage Case Water-Resistant Hard Holder with Tester

JJC£18.99Buy on AmazonPrice checked 12/10/2026

JJC 34 Slot AA AAA Battery Storage Case Water-Resistant Holder with Tester

JJC 34 Slot AA AAA Battery Storage Case Water-Resistant Holder with Tester

JJC£18.99Buy on AmazonPrice checked 12/10/2026

6000mAh Bedside Lamps, 10.8" Touch Control Rechargeable Table Lamp with Wood Grained Base & Fabric Lampshade, Dimmable Minimalist Wireless Battery Lamp for Living Room Bedroom Office Decor (1)

6000mAh Bedside Lamps, 10.8" Touch Control Rechargeable Table Lamp with Wood Grained Base & Fabric Lampshade, Dimmable Minimalist Wireless Battery Lamp for Living Room Bedroom Office Decor (1)

Suolita£15.99Buy on AmazonPrice checked 12/10/2026

POPCHOSE Bobble Remover for Clothes, USB Rechargeable Fabric Shaver

POPCHOSE Bobble Remover for Clothes, USB Rechargeable Fabric Shaver

POPCHOSE£10.99Buy on AmazonPrice checked 12/10/2026

EppieBasic Rechargeable Cordless Table Lamp, 2700K Dimmable, Small

EppieBasic Rechargeable Cordless Table Lamp, 2700K Dimmable, Small

EppieBasic£25.99Buy on AmazonPrice checked 12/10/2026

TOUCHBeauty Battery Operated Fabric Shaver, Portable Lint Remover for Clothes & Furniture with Detachable Lint Container, Stainless Steel Blades, Handheld Bobble Remover for Sweaters, Coats & Sofas

TOUCHBeauty Battery Operated Fabric Shaver, Portable Lint Remover for Clothes & Furniture with Detachable Lint Container, Stainless Steel Blades, Handheld Bobble Remover for Sweaters, Coats & Sofas

TOUCHBeauty£7.59Buy on AmazonPrice checked 12/10/2026

JML Magic Stitch Handheld Sewing Machine – Portable Mini Stitch Repair

JML Magic Stitch Handheld Sewing Machine – Portable Mini Stitch Repair

JML£4.99Buy on AmazonPrice checked 12/10/2026

BEAUTURAL Portable Fabric Shaver with 2 Speeds, 3 Adjustable Shave Heights

BEAUTURAL Portable Fabric Shaver with 2 Speeds, 3 Adjustable Shave Heights

BEAUTURAL£8.99Buy on AmazonPrice checked 12/10/2026

SLSMD 2 Pack Cordless Table Lamp IP54 Battery Operated Desk Lights 5000mAh Rechargeable Aluminum Metal Night Light 3 Color & Stepless Dimming Lamps Portable LED Lamps (2 Pack Titanium)

SLSMD 2 Pack Cordless Table Lamp IP54 Battery Operated Desk Lights 5000mAh Rechargeable Aluminum Metal Night Light 3 Color & Stepless Dimming Lamps Portable LED Lamps (2 Pack Titanium)

SLSMD£29.99Buy on AmazonPrice checked 12/10/2026

Linkind Camping Light Battery Powered, Retro Style Dimmable Warm White and Daylight Waterproof Camping Lamp, Up to 200H Run Time, Portable Atmosphere Tent Lights for Indoor & Outdoor Use

Linkind Camping Light Battery Powered, Retro Style Dimmable Warm White and Daylight Waterproof Camping Lamp, Up to 200H Run Time, Portable Atmosphere Tent Lights for Indoor & Outdoor Use

Linkind£19.95Buy on AmazonPrice checked 12/10/2026

Portable Soil Ph Tester With Metal Probe For Garden Plants Offering Quick 3 To 11 Level Readings Without For Battery Need In Fields

Portable Soil Ph Tester With Metal Probe For Garden Plants Offering Quick 3 To 11 Level Readings Without For Battery Need In Fields

RichVibe£7.09Buy on AmazonPrice checked 12/10/2026

sourcing map Battery Organizer Storage Box, 2 x 18650 Batteries Plastic Clear Battery Storage Case Holder Garage Container Portable Organizer for Travelling, Home, Office, Garage (Pack of 2)

sourcing map Battery Organizer Storage Box, 2 x 18650 Batteries Plastic Clear Battery Storage Case Holder Garage Container Portable Organizer for Travelling, Home, Office, Garage (Pack of 2)

sourcing map£3.99Buy on AmazonPrice checked 12/10/2026

Cordless Plastic Welding Kit,2 in1 Plastic Welder Gun with 200pcs Staples,15pcs Rods,3 Soldering Tips,Led Work Light,2.0Ah Battery,Hot Stapler Plastic Welder Repair Kit for Bumper Crack Repair

Cordless Plastic Welding Kit,2 in1 Plastic Welder Gun with 200pcs Staples,15pcs Rods,3 Soldering Tips,Led Work Light,2.0Ah Battery,Hot Stapler Plastic Welder Repair Kit for Bumper Crack Repair

Luqixcey£32.99Buy on AmazonPrice checked 12/10/2026

AA/AAA Battery Storage Box - 3 Pcs Clear Portable Plastic Battery Cases 62 * 60 * 18CM Batteries Storage Boxes for AA AAA Batteries and Rechargeable Batteries

AA/AAA Battery Storage Box - 3 Pcs Clear Portable Plastic Battery Cases 62 * 60 * 18CM Batteries Storage Boxes for AA AAA Batteries and Rechargeable Batteries

GLADFRESIT£4.49Buy on AmazonPrice checked 12/10/2026

9 PCS AA/AAA Cell Battery Storage Cases, Hard Plastic Batteries Storage Boxes for AA/AAA Cells and Rechargeable Batteries, Clear Cells Holder (Hyaline)

9 PCS AA/AAA Cell Battery Storage Cases, Hard Plastic Batteries Storage Boxes for AA/AAA Cells and Rechargeable Batteries, Clear Cells Holder (Hyaline)

WSHuayee£4.79Buy on AmazonPrice checked 12/10/2026

NAYAGOGO 9 Pcs Clear Plastic Cell Battery Storage Case Holder Box, AA/AAA Cell Battery Storage Case, Battery Case Hard Plastic Batteries Storage Boxes, for AA/AAA Batteries and Rechargeable Batteries

NAYAGOGO 9 Pcs Clear Plastic Cell Battery Storage Case Holder Box, AA/AAA Cell Battery Storage Case, Battery Case Hard Plastic Batteries Storage Boxes, for AA/AAA Batteries and Rechargeable Batteries

NAYAGOGO£4.99Buy on AmazonPrice checked 12/10/2026

AFMAT Electric Eraser for Artists with 140 Refills, Rechargeable Electric Rubbers for Artists,2 Sizes,Automatic Portable Pencil Eraser for Drafting,Painting, Sketching, Detailer Tool-Blue EE15

AFMAT Electric Eraser for Artists with 140 Refills, Rechargeable Electric Rubbers for Artists,2 Sizes,Automatic Portable Pencil Eraser for Drafting,Painting, Sketching, Detailer Tool-Blue EE15

AFMAT£12.99Buy on AmazonPrice checked 12/10/2026

Foyucool Electric Eraser for Artists, 220pcs Refills & 2.3/5mm Sizes

Foyucool Electric Eraser for Artists, 220pcs Refills & 2.3/5mm Sizes

Foyucool£7.49Buy on AmazonPrice checked 12/10/2026

Cuteefun Electric Eraser, Electric Rubber for Art, Battery Powered, Black

Cuteefun Electric Eraser, Electric Rubber for Art, Battery Powered, Black

Cuteefun£7.49Buy on AmazonPrice checked 12/10/2026

RING Shockproof Rubber LED Torch, 2 x AA Batteries Included

RING Shockproof Rubber LED Torch, 2 x AA Batteries Included

RING£4.14Buy on AmazonPrice checked 12/10/2026

OFFCUP Electric Eraser, Portable Pencil Eraser, 22pcs Refills - Automatic Rubber for Sketching/Drafting/Drawing/Graphite Pencils - Grey

OFFCUP Electric Eraser, Portable Pencil Eraser, 22pcs Refills - Automatic Rubber for Sketching/Drafting/Drawing/Graphite Pencils - Grey

OFFCUP£5.99Buy on AmazonPrice checked 12/10/2026

OFFCUP Electric Automatic Portable Pencil & Eraser 22pcs Refills, Battery Operated Eraser for Sketching Graphite Pencils/Drafting

OFFCUP Electric Automatic Portable Pencil & Eraser 22pcs Refills, Battery Operated Eraser for Sketching Graphite Pencils/Drafting

OFFCUP£4.99Buy on AmazonPrice checked 12/10/2026

Electric Eraser, Battery Operated Eraser Kit with 22 Extra Replaceable Erasers for Artists, Automatic Portable Pencil Eraser for Sketching, Drawing, Graphite Pencils

Electric Eraser, Battery Operated Eraser Kit with 22 Extra Replaceable Erasers for Artists, Automatic Portable Pencil Eraser for Sketching, Drawing, Graphite Pencils

Tihoo£6.99Buy on AmazonPrice checked 12/10/2026

SUNWERK Portable Nebuliser Machine for Adults, 1800mah Rechargeable Mesh Nebuliser, Self-Cleaning Digital Display & Silent Handheld Nebulizer with Adjustable Mist for Home and Travel

SUNWERK Portable Nebuliser Machine for Adults, 1800mah Rechargeable Mesh Nebuliser, Self-Cleaning Digital Display & Silent Handheld Nebulizer with Adjustable Mist for Home and Travel

SUNWERK£14.99Buy on AmazonPrice checked 12/10/2026

Warmco Portable Pram Fan, 4000mAh Rechargeable Clip On Fan

Warmco Portable Pram Fan, 4000mAh Rechargeable Clip On Fan

Warmco£19.98Buy on AmazonPrice checked 12/10/2026

NebuLiva Portable Nebuliser for Adults & Kids

NebuLiva Portable Nebuliser for Adults & Kids

NebuLiva£24.99Buy on AmazonPrice checked 12/10/2026

lulir Portable Nebuliser Machine for Adults & Kids, Rechargeable

lulir Portable Nebuliser Machine for Adults & Kids, Rechargeable

lulir£9.99Buy on AmazonPrice checked 12/10/2026

HANGSUN Rechargeable Portable Mesh Nebuliser Machine for Adults & Kids

HANGSUN Rechargeable Portable Mesh Nebuliser Machine for Adults & Kids

HANGSUN£24.99Buy on AmazonPrice checked 12/10/2026

FACHOI Cotton Ball Fairy Lights, 1.5m/4.92ft Battery Powered String Lights, 10 LED Colorful Cotton Ball String Lights for Bedroom Wedding Party Home Christmas Decoration F6-MXQDD (Macaron)

FACHOI Cotton Ball Fairy Lights, 1.5m/4.92ft Battery Powered String Lights, 10 LED Colorful Cotton Ball String Lights for Bedroom Wedding Party Home Christmas Decoration F6-MXQDD (Macaron)

FACHOI£6.98Buy on AmazonPrice checked 12/10/2026

Portable Travel Steam Iron, Cordless Mini Handheld Steamer

Portable Travel Steam Iron, Cordless Mini Handheld Steamer

KALLORY£18.89Buy on AmazonPrice checked 12/10/2026

Kivdes Cordless Heating Pad Rechargeable ，Electric Wearable Heat Pad

Kivdes Cordless Heating Pad Rechargeable ，Electric Wearable Heat Pad

Kivdes£23.46Buy on AmazonPrice checked 12/10/2026

TEHAUX Travel Cord Organizer Bag for USB Cables and Batteries, Portable Polyester Electronics Accessory Carrying Case with Zipper Closure, Easy to Carry for Car and Traveling Storage Grey

TEHAUX Travel Cord Organizer Bag for USB Cables and Batteries, Portable Polyester Electronics Accessory Carrying Case with Zipper Closure, Easy to Carry for Car and Traveling Storage Grey

TEHAUX£7.19Buy on AmazonPrice checked 12/10/2026

Yhenlovtt Electric Bike-Charger Storage Bag, Shockproof EVA Case for E-Bike Power Adapter and Scooter, 800D Polyester Portable Battery-Box with Handle, Black(25.5 * 19 * 10cm）)

Yhenlovtt Electric Bike-Charger Storage Bag, Shockproof EVA Case for E-Bike Power Adapter and Scooter, 800D Polyester Portable Battery-Box with Handle, Black(25.5 * 19 * 10cm）)

Yhenlovtt£9.25Buy on AmazonPrice checked 12/10/2026

USB Cable Bag Travel Digital Accessories Organizer Compartments

USB Cable Bag Travel Digital Accessories Organizer Compartments

Operitacx£5.91Buy on AmazonPrice checked 12/10/2026

BEOSIOR Camping Single Airbed with Automatic Battery Pump, Flocked Inflatable Bed Portable, Air Mattress, Outdoor Camping Air Bed (Single 25CM)

BEOSIOR Camping Single Airbed with Automatic Battery Pump, Flocked Inflatable Bed Portable, Air Mattress, Outdoor Camping Air Bed (Single 25CM)

BEOSIOR£39.99Buy on AmazonPrice checked 12/10/2026

JJC Polyester Battery Pouch with Zippered Pocket for 8 Pcs 18650 & SD Card

JJC Polyester Battery Pouch with Zippered Pocket for 8 Pcs 18650 & SD Card

JJC£8.99Buy on AmazonPrice checked 12/10/2026

lomitech Travel Pillow with 3 Vibration Modes,Airplane Neck Massage Pillow

lomitech Travel Pillow with 3 Vibration Modes,Airplane Neck Massage Pillow

lomitech£19.99Buy on AmazonPrice checked 12/10/2026

2025 Upgraded Lipo Battery Fireproof Explosionproof Safe Bag,4 Layers of Heat Insulated Materials with Waterproof Zipper/Reflective Strip,Comfortable Handle/Portable Shoulder Strap(8.5x5.7x6.5inch)

2025 Upgraded Lipo Battery Fireproof Explosionproof Safe Bag,4 Layers of Heat Insulated Materials with Waterproof Zipper/Reflective Strip,Comfortable Handle/Portable Shoulder Strap(8.5x5.7x6.5inch)

WJTZDZ£15.99Buy on AmazonPrice checked 12/10/2026

3 X AA Battery Holder Case with USB Port, 4.5V Portable Battery Power Bank, Battery Box for LED Strip, Fairy String Lights, Curtain Lights, Indoor‑Outdoor DIY Lighting Projects (Milky white, 2 Pcs)

3 X AA Battery Holder Case with USB Port, 4.5V Portable Battery Power Bank, Battery Box for LED Strip, Fairy String Lights, Curtain Lights, Indoor‑Outdoor DIY Lighting Projects (Milky white, 2 Pcs)

WSHuayee£1.99Buy on AmazonPrice checked 12/10/2026

Waterproof Electric Bike Battery Bag, Light and Portable

Waterproof Electric Bike Battery Bag, Light and Portable

Generic£12.39Buy on AmazonPrice checked 12/10/2026

LALADEFIEE Air Compressor Carrier Bag Portable Car Vacuum Cleaner Inflator Pump Storage Bag Foldable Canvas Tire Pump Carrier for Compressor Ideal for Vehicle Accessories

LALADEFIEE Air Compressor Carrier Bag Portable Car Vacuum Cleaner Inflator Pump Storage Bag Foldable Canvas Tire Pump Carrier for Compressor Ideal for Vehicle Accessories

LALADEFIEE£11.39Buy on AmazonPrice checked 12/10/2026

KinYiLO Portable Handheld Fan with 4000mAh Battery – 100-Speed Rechargeable Personal Cooling Fan, 16-Hour Runtime, 3-in-1 Desk & Handheld & Tilt Fan, Ultra-Quiet for Travel Beach Office, (Pink)

KinYiLO Portable Handheld Fan with 4000mAh Battery – 100-Speed Rechargeable Personal Cooling Fan, 16-Hour Runtime, 3-in-1 Desk & Handheld & Tilt Fan, Ultra-Quiet for Travel Beach Office, (Pink)

KinYiLO£13.99Buy on AmazonPrice checked 12/10/2026

Eyebrow Trimmer Ladies' Eyebrow Shaper Facial Hair Remover Trimmer Portable Eyebrow Hair Removal Razor, Painless Portable Electric Razor, Battery Operated (No Battery)

Eyebrow Trimmer Ladies' Eyebrow Shaper Facial Hair Remover Trimmer Portable Eyebrow Hair Removal Razor, Painless Portable Electric Razor, Battery Operated (No Battery)

Rosarden£5.69Buy on AmazonPrice checked 12/10/2026

QODOSEN DX-286 Portable Radio Accessories Package (Including: Battery Cover*1, Support Plate*2, Telescopic Antenna*1,Canvas Bag with Velcro Closure*1,Rubber Foot pad*2)

QODOSEN DX-286 Portable Radio Accessories Package (Including: Battery Cover1, Support Plate2, Telescopic Antenna1,Canvas Bag with Velcro Closure1,Rubber Foot pad*2)

QODOSEN£12.76Buy on AmazonPrice checked 12/10/2026

KinYiLO Portable Handheld Fan with 4000mAh Battery – 100-Speed Rechargeable Personal Cooling Fan, 16-Hour Runtime, 3-in-1 Desk & Handheld & Tilt Fan, Ultra-Quiet for Travel Beach Office, (Beige)

KinYiLO Portable Handheld Fan with 4000mAh Battery – 100-Speed Rechargeable Personal Cooling Fan, 16-Hour Runtime, 3-in-1 Desk & Handheld & Tilt Fan, Ultra-Quiet for Travel Beach Office, (Beige)

KinYiLO£11.89Buy on AmazonPrice checked 12/10/2026

KinYiLO Portable Handheld Fan with 4000mAh Battery – 100-Speed Rechargeable Personal Cooling Fan, 16-Hour Runtime, 3-in-1 Desk & Handheld & Tilt Fan, Ultra-Quiet for Travel Beach Office Outdoor, Black

KinYiLO Portable Handheld Fan with 4000mAh Battery – 100-Speed Rechargeable Personal Cooling Fan, 16-Hour Runtime, 3-in-1 Desk & Handheld & Tilt Fan, Ultra-Quiet for Travel Beach Office Outdoor, Black

KinYiLO£11.89Buy on AmazonPrice checked 12/10/2026

TOHETO A4 Rechargeable Led Super Bright Light Pad Powered by 3500mAh Lithium Battery for Weeding Vinyl Tool, Portable Wireless Light Board/Box for Tracing, Diamond Painting, Sketching & Drawing

TOHETO A4 Rechargeable Led Super Bright Light Pad Powered by 3500mAh Lithium Battery for Weeding Vinyl Tool, Portable Wireless Light Board/Box for Tracing, Diamond Painting, Sketching & Drawing

TOHETO£23.99Buy on AmazonPrice checked 12/10/2026

Savorluxe Electric Milk Frother - Stainless Steel Egg Beater - Portable Battery-Powered Handheld Milk Frother, Suitable for Lattes, Cappuccinos, Matcha & More - with Dust Cover, Matte Black & Silver

Savorluxe Electric Milk Frother - Stainless Steel Egg Beater - Portable Battery-Powered Handheld Milk Frother, Suitable for Lattes, Cappuccinos, Matcha & More - with Dust Cover, Matte Black & Silver

Savorluxe£9.50Buy on AmazonPrice checked 12/10/2026

Portable Travel Kettle 500ml, Electric Kettle with 6 Temperature Settings

Portable Travel Kettle 500ml, Electric Kettle with 6 Temperature Settings

YUEJIDZ£22.87Buy on AmazonPrice checked 12/10/2026

iKuchelife Cordless Heated Electric Lunch Box, 24000mAh, 1.2L Lunchbox

iKuchelife Cordless Heated Electric Lunch Box, 24000mAh, 1.2L Lunchbox

iKuchelife£65.99Buy on AmazonPrice checked 12/10/2026

Fagalil 1L Cordless Electric Lunch Box for Adults

Fagalil 1L Cordless Electric Lunch Box for Adults

Fagalil£45.49Buy on AmazonPrice checked 12/10/2026

Portable Rechargeable Travel Coffee Bean Grinder, 420 Stainless Steel Burr

Portable Rechargeable Travel Coffee Bean Grinder, 420 Stainless Steel Burr

SIGBOT£37.99Buy on AmazonPrice checked 12/10/2026

Keplin Handheld Milk Frother - Stainless Steel Electric Whisk - Portable Battery Operated Coffee Stirrer for Lattes, Matcha, Protein Shakes - Ergonomic, Compact, Easy to Clean & Use (Cream)

Keplin Handheld Milk Frother - Stainless Steel Electric Whisk - Portable Battery Operated Coffee Stirrer for Lattes, Matcha, Protein Shakes - Ergonomic, Compact, Easy to Clean & Use (Cream)

KEPLIN£5.99Buy on AmazonPrice checked 12/10/2026

GRIFEMA Milk Frother Handheld, Electric Whisk Battery Operated

GRIFEMA Milk Frother Handheld, Electric Whisk Battery Operated

GRIFEMA£5.99Buy on AmazonPrice checked 12/10/2026

Fagalil Cordless Heated Lunch Box, 1.2L Battery Powered

Fagalil Cordless Heated Lunch Box, 1.2L Battery Powered

Fagalil£40.00Buy on AmazonPrice checked 12/10/2026

eSynic 16~300Ω Portable Headphone Amplifier With Bass Gain

eSynic 16~300Ω Portable Headphone Amplifier With Bass Gain

eSynic£19.99Buy on AmazonPrice checked 12/10/2026

Insulin Cooler Travel Case Portable – Electric Medication Cooler Box for 3 Insulin Pens and Cartridges, with 13600mAh Battery & 0-18°C Precise Temperature Control, Rugged Aluminum Interior

Insulin Cooler Travel Case Portable – Electric Medication Cooler Box for 3 Insulin Pens and Cartridges, with 13600mAh Battery & 0-18°C Precise Temperature Control, Rugged Aluminum Interior

VexNook£65.19Buy on AmazonPrice checked 12/10/2026

Waterless Diffuser for Essential Oil, 7 Colors LED Light，Aluminum Alloy

Waterless Diffuser for Essential Oil, 7 Colors LED Light，Aluminum Alloy

KONCHILE£16.14Buy on AmazonPrice checked 12/10/2026

Waterless Diffuser for Essential Oil Nebulizer, aluminum alloy

Waterless Diffuser for Essential Oil Nebulizer, aluminum alloy

SHXMZS£16.98Buy on AmazonPrice checked 12/10/2026

UNEEDE Duck Night Light for Kids, Cute Silicone Baby Lamp Touch Control

UNEEDE Duck Night Light for Kids, Cute Silicone Baby Lamp Touch Control

UNEEDE£12.99Buy on AmazonPrice checked 12/10/2026

PORUPAEL Cloud Night Light, Cute LED Silicone Squishy Lamp, USB Rechargeable & 3-Level Dimmable, Portable Bedside Touch Night Lamp with Timer, Gift for Girls, Boys, and Teens

PORUPAEL Cloud Night Light, Cute LED Silicone Squishy Lamp, USB Rechargeable & 3-Level Dimmable, Portable Bedside Touch Night Lamp with Timer, Gift for Girls, Boys, and Teens

PORUPAEL£9.99Buy on AmazonPrice checked 12/10/2026

MediAcous Baby Night Light, 7 Colors & Dimming, Rechargeable

MediAcous Baby Night Light, 7 Colors & Dimming, Rechargeable

MediAcous£19.99Buy on AmazonPrice checked 12/10/2026

Eujgoov XT150 to Battery Clip Cable for Ecoflow Delta Power Station 1.5m

Eujgoov XT150 to Battery Clip Cable for Ecoflow Delta Power Station 1.5m

Eujgoov£31.97Buy on AmazonPrice checked 12/10/2026

CHICAMPERA Handheld Radio Case for Uv5r Uv-5re Uv-82, Black EVA

CHICAMPERA Handheld Radio Case for Uv5r Uv-5re Uv-82, Black EVA

CHICAMPERA£9.09Buy on AmazonPrice checked 12/10/2026

3Pcs Portable EVA Earphone Storage Pouch Cable Organiser Bag

3Pcs Portable EVA Earphone Storage Pouch Cable Organiser Bag

SAFIGLE£5.99Buy on AmazonPrice checked 12/10/2026

BXAXGX Shoulder Bag Travel Case for EON ONE Compact All-in-1 Personal PA System Portable Speaker w/Pockets for Microphone, Transmitter, Tablet, Power Cord, Spare Battery Accessories(Nylon Bag)

BXAXGX Shoulder Bag Travel Case for EON ONE Compact All-in-1 Personal PA System Portable Speaker w/Pockets for Microphone, Transmitter, Tablet, Power Cord, Spare Battery Accessories(Nylon Bag)

BXAXGX£44.99Buy on AmazonPrice checked 12/10/2026

Tactical External Battery Pouch Portable Molle Sport Pouches Universal Hunting Durable Nylon Military Paintball Battery Holder

Tactical External Battery Pouch Portable Molle Sport Pouches Universal Hunting Durable Nylon Military Paintball Battery Holder

ACEXIER£8.99Buy on AmazonPrice checked 12/10/2026

StaZamor 4PCS Portable Hanging Battery Operated LED Pull Cord Light Bulb, Camping Lamp for Party, Weddings, Festivals, Child Room Decoration (Not Included)

StaZamor 4PCS Portable Hanging Battery Operated LED Pull Cord Light Bulb, Camping Lamp for Party, Weddings, Festivals, Child Room Decoration (Not Included)

StaZamor£9.79Buy on AmazonPrice checked 12/10/2026

Cordless Soldering Iron with LCD, USB-C Rechargeable Pen 260-420°C

Cordless Soldering Iron with LCD, USB-C Rechargeable Pen 260-420°C

ZestEcho£12.99Buy on AmazonPrice checked 12/10/2026

DAB/DAB+ & FM Portable Digital Radio | Leather Design | Bluetooth | Battery & Mains Powered (4x”C”) | Dual Alarms & Sleep Timer | Perfect for Home, Office or Outdoors | AZATOM Classic (Black/Gold)

DAB/DAB+ & FM Portable Digital Radio | Leather Design | Bluetooth | Battery & Mains Powered (4x”C”) | Dual Alarms & Sleep Timer | Perfect for Home, Office or Outdoors | AZATOM Classic (Black/Gold)

AZATOM£48.95Buy on AmazonPrice checked 12/10/2026

Gueray Portable Leather CD Player Bluetooth with Speakers 3600mAh Battery

Gueray Portable Leather CD Player Bluetooth with Speakers 3600mAh Battery

Gueray£59.99Buy on AmazonPrice checked 12/10/2026

Pluto Dry Herb Vaporiser, Portable Pen-Style Herbal Vaporiser with 3 Precise Temperature Settings, 1100mAh Rechargeable Battery, Premium Leather Design for Daily Use & Travel

Pluto Dry Herb Vaporiser, Portable Pen-Style Herbal Vaporiser with 3 Precise Temperature Settings, 1100mAh Rechargeable Battery, Premium Leather Design for Daily Use & Travel

MGO£25.98Buy on AmazonPrice checked 12/10/2026

DAB/DAB+ & FM Portable Digital Radio | Leather Design | Bluetooth | Rechargeable Battery | Dual Alarms & Sleep Timer | Perfect for Home, Office or Outdoors | AZATOM Spitalfields 2 (Grey)

DAB/DAB+ & FM Portable Digital Radio | Leather Design | Bluetooth | Rechargeable Battery | Dual Alarms & Sleep Timer | Perfect for Home, Office or Outdoors | AZATOM Spitalfields 2 (Grey)

AZATOM£44.95Buy on AmazonPrice checked 12/10/2026

DAB/DAB+ & FM Portable Digital Radio | Leather Design | Bluetooth | Rechargeable Battery | Dual Alarms & Sleep Timer | Perfect for Home, Office or Outdoors | AZATOM Spitalfields 2 (White)

DAB/DAB+ & FM Portable Digital Radio | Leather Design | Bluetooth | Rechargeable Battery | Dual Alarms & Sleep Timer | Perfect for Home, Office or Outdoors | AZATOM Spitalfields 2 (White)

AZATOM£44.95Buy on AmazonPrice checked 12/10/2026

Mini Keychain Camera G6 1080P HD Thumb Camera 0.96" LCD 130° Wide Angle

Mini Keychain Camera G6 1080P HD Thumb Camera 0.96" LCD 130° Wide Angle

Generic£12.98Buy on AmazonPrice checked 12/10/2026

Car Battery Jump Starter Powerful Battery Pack Automotive Booster Double

Car Battery Jump Starter Powerful Battery Pack Automotive Booster Double

Generic£8.89Buy on AmazonPrice checked 12/10/2026

Portable Bottle Warmer, Rechargeable Baby Bottle Warmer with 6-Speed Adjustable Temperature and 18W Fast Heating, Baby Milk Warmer with LED Temperature Display and Night Light, Travel-Friendly

Portable Bottle Warmer, Rechargeable Baby Bottle Warmer with 6-Speed Adjustable Temperature and 18W Fast Heating, Baby Milk Warmer with LED Temperature Display and Night Light, Travel-Friendly

laloohome£23.99Buy on AmazonPrice checked 12/10/2026

Electric Jump Starter Quick Charging Powerful Battery Pack Automotive

Electric Jump Starter Quick Charging Powerful Battery Pack Automotive

Generic£8.19Buy on AmazonPrice checked 12/10/2026

Portable Power Pack Automotive Booster Quick Charging Double USB

Portable Power Pack Automotive Booster Quick Charging Double USB

Generic£7.79Buy on AmazonPrice checked 12/10/2026

Kixolazr Portable Milk Warmer, Portable Battery-Powered Smart Display Supplies, Milk Bottle Warmer, for Feeding Nursery Night Morning Travel Winter Fall Home Outdoor Shopping Walking Car

Kixolazr Portable Milk Warmer, Portable Battery-Powered Smart Display Supplies, Milk Bottle Warmer, for Feeding Nursery Night Morning Travel Winter Fall Home Outdoor Shopping Walking Car

Kixolazr£6.46Buy on AmazonPrice checked 12/10/2026

Jump Starter Battery Pack Double USB Quick Charging Powerful Battery Pack

Jump Starter Battery Pack Double USB Quick Charging Powerful Battery Pack

Generic£6.39Buy on AmazonPrice checked 12/10/2026

White Noise Machine for Baby Adult, Portable Sound Machine with 21 Natural Soothing Sound, Memory Function, Powerful Battery & 32 Levels of Volume, Sleep Aid Sound Machine for Sleeping Nursery Travel

White Noise Machine for Baby Adult, Portable Sound Machine with 21 Natural Soothing Sound, Memory Function, Powerful Battery & 32 Levels of Volume, Sleep Aid Sound Machine for Sleeping Nursery Travel

FEKTIK£16.14Buy on AmazonPrice checked 12/10/2026

Fenxyo Portable Handheld Turbo Fan, 4000mAh Rechargeable Personal Fan, 12Hrs Cooling, 14000RPM Powerful, 5 Speeds, 180° Foldable Battery Operated USB-C Mini Hand Fan for Travel, Outdoor (Black)

Fenxyo Portable Handheld Turbo Fan, 4000mAh Rechargeable Personal Fan, 12Hrs Cooling, 14000RPM Powerful, 5 Speeds, 180° Foldable Battery Operated USB-C Mini Hand Fan for Travel, Outdoor (Black)

Fenxyo£17.99Buy on AmazonPrice checked 12/10/2026

Handheld Fan, 19H Portable USB Hand Held Fans Rechargeable with 5 Speeds, Power Display, Battery Operated Desk Fan, Small Personal Fan with Base, Hanging Rope, Suit for Home Office Travel Essentials

Handheld Fan, 19H Portable USB Hand Held Fans Rechargeable with 5 Speeds, Power Display, Battery Operated Desk Fan, Small Personal Fan with Base, Hanging Rope, Suit for Home Office Travel Essentials

LITOHOM£7.99Buy on AmazonPrice checked 12/10/2026

Sorbay Rechargeable Travel Mirror With Light Up Camping Portable Mirror With Lights Touch Make Up Compact Mirrors LED Folding Makeup Mirrors with 3 Color Lighting & Adjustable Brightness (UK BRAND)

Sorbay£9.99Buy on AmazonPrice checked 12/10/2026

TriPole 4000mAh Rechargeable Desk Fan 31H Runtime, 4 Speed Portable USB Fan with LED Display, Battery Operated Ultra Quiet Table Fans, Head Adjustable for Office, Bedroom, Camping, Travel (Black)

TriPole 4000mAh Rechargeable Desk Fan 31H Runtime, 4 Speed Portable USB Fan with LED Display, Battery Operated Ultra Quiet Table Fans, Head Adjustable for Office, Bedroom, Camping, Travel (Black)

TriPole£16.99Buy on AmazonPrice checked 12/10/2026

Metal Detector Wand, High Sensitivity with Vibration Alarm

Metal Detector Wand, High Sensitivity with Vibration Alarm

Yosoo Health Gear£18.27Buy on AmazonPrice checked 12/10/2026

Portable Hand Crank for charger for Camping Hiking Trip Portable

Portable Hand Crank for charger for Camping Hiking Trip Portable

EcoLivzen£6.57Buy on AmazonPrice checked 12/10/2026

Solar Charger 10000mAh Hiking Waterproof Power Bank

Solar Charger 10000mAh Hiking Waterproof Power Bank

Zhajipai£9.67Buy on AmazonPrice checked 12/10/2026

Portable Fan with Mist - Battery Operated Handheld Slim - Handheld Fan Rechargeable Small Mister - for Home Office Indoor Outdoor Summer Camping Hiking Fishing Travel Trip Women Men

Portable Fan with Mist - Battery Operated Handheld Slim - Handheld Fan Rechargeable Small Mister - for Home Office Indoor Outdoor Summer Camping Hiking Fishing Travel Trip Women Men

Generic£9.90Buy on AmazonPrice checked 12/10/2026

LED Camping Light – Rechargeable Cordless Lantern, Lamp | Warm Light Table Lamp for Bedroom Tent Living Room Patio, USB Portable Light Source for Hiking Trips Power Cuts Cruise Use, Compact

LED Camping Light – Rechargeable Cordless Lantern, Lamp | Warm Light Table Lamp for Bedroom Tent Living Room Patio, USB Portable Light Source for Hiking Trips Power Cuts Cruise Use, Compact

Generic£10.29Buy on AmazonPrice checked 12/10/2026

Water Fan | Battery Operated Handheld Slim,Desk Cooling Portable Mist Fan - for Home Office Indoor Outdoor Summer Camping Hiking Fishing Travel Trip Women Men

Water Fan | Battery Operated Handheld Slim,Desk Cooling Portable Mist Fan - for Home Office Indoor Outdoor Summer Camping Hiking Fishing Travel Trip Women Men

Generic£7.19Buy on AmazonPrice checked 12/10/2026

Fan with Mist - 3-Speed Quiet Battery Operated Small - Handheld Fan Portable Mister,for Bedroom Office School Summer Outdoor Travel Camping Hiking Beach Trip Women Kids

Fan with Mist - 3-Speed Quiet Battery Operated Small - Handheld Fan Portable Mister,for Bedroom Office School Summer Outdoor Travel Camping Hiking Beach Trip Women Kids

Generic£7.99Buy on AmazonPrice checked 12/10/2026

Battery Blower Portable Rechargeable Handheld Blowing Cleaning Fan

Battery Blower Portable Rechargeable Handheld Blowing Cleaning Fan

Generic£43.39Buy on AmazonPrice checked 12/10/2026

Battery Blower Portable Rechargeable Handheld Blowing Cleaning Fan

Battery Blower Portable Rechargeable Handheld Blowing Cleaning Fan

Generic£39.26Buy on AmazonPrice checked 12/10/2026

Battery Blower Portable Rechargeable Handheld Blowing Cleaning Fan

Battery Blower Portable Rechargeable Handheld Blowing Cleaning Fan

Generic£34.49Buy on AmazonPrice checked 12/10/2026

Electric Air Duster Blow-Suck Dual-Purpose

Electric Air Duster Blow-Suck Dual-Purpose

Generic£16.61Buy on AmazonPrice checked 12/10/2026

NbgrvB for Spark Gap Set with 32 Steel Gauge 10 12 14 16mm Sizes

NbgrvB for Spark Gap Set with 32 Steel Gauge 10 12 14 16mm Sizes

NbgrvB£17.39Buy on AmazonPrice checked 12/10/2026

Handheld Air Duster Blow-Suck Dual-Purpose

Handheld Air Duster Blow-Suck Dual-Purpose

Generic£12.09Buy on AmazonPrice checked 12/10/2026

Translator Earbuds Two-Way Instant, Long Battery Life, Portable

Translator Earbuds Two-Way Instant, Long Battery Life, Portable

Generic£14.54Buy on AmazonPrice checked 12/10/2026

Translation Headphones Instant Translate Long Battery Life Portable

Translation Headphones Instant Translate Long Battery Life Portable

Generic£14.78Buy on AmazonPrice checked 12/10/2026

Translation Earbuds Real Time Instant Translate Long Battery Life Portable

Translation Earbuds Real Time Instant Translate Long Battery Life Portable

Generic£12.78Buy on AmazonPrice checked 12/10/2026

Uomianty Translation Earbuds Instant Translate Long Battery Life Portable

Uomianty Translation Earbuds Instant Translate Long Battery Life Portable

Uomianty£13.20Buy on AmazonPrice checked 12/10/2026

Translation Earbuds Two-Way Instant, Long Battery Life, Portable

Translation Earbuds Two-Way Instant, Long Battery Life, Portable

Opilroyn£11.69Buy on AmazonPrice checked 12/10/2026

Translation Earbuds Real Time Instant Translate Long Battery Life Portable

Translation Earbuds Real Time Instant Translate Long Battery Life Portable

Generic£12.35Buy on AmazonPrice checked 12/10/2026

Translation Earbuds Real Time Instant Translate Long Battery Life Portable

Translation Earbuds Real Time Instant Translate Long Battery Life Portable

Generic£10.49Buy on AmazonPrice checked 12/10/2026

Translation Earbuds Instant Translate Long Battery Life Portable

Translation Earbuds Instant Translate Long Battery Life Portable

Generic£10.86Buy on AmazonPrice checked 12/10/2026

Translation Earbuds Instant Translate Long Battery Life Portable

Translation Earbuds Instant Translate Long Battery Life Portable

Generic£10.39Buy on AmazonPrice checked 12/10/2026

BLUETTI Elite 30 V2 Portable Power Station 288Wh(Renewed)

BLUETTI Elite 30 V2 Portable Power Station 288Wh(Renewed)

BLUETTI£227.00Buy on AmazonPrice checked 12/10/2026

VTOMAN 2956Wh Portable Power Station with Extra Battery & 110W Solar Panel

VTOMAN 2956Wh Portable Power Station with Extra Battery & 110W Solar Panel

VTOMAN£979.99Buy on AmazonPrice checked 12/10/2026

Spray Bottle Fan 350ml Battery Powered Portable Powerful

Spray Bottle Fan 350ml Battery Powered Portable Powerful

Generic£4.74Buy on AmazonPrice checked 12/10/2026

Water Misting Fan with Light Foldable Rechargeable 2400mAh Battery

Water Misting Fan with Light Foldable Rechargeable 2400mAh Battery

Generic£5.90Buy on AmazonPrice checked 12/10/2026

Portable Charger 22.5W Smartphone Charging

Portable Charger 22.5W Smartphone Charging

Dewireaey£12.29Buy on AmazonPrice checked 12/10/2026

Travel Alarm Clock with Backlight, 12/24H Display, Calendar and Temperature, Weekend Mode, Compact Portable Design for Bedside Desk, Battery Operated(White)

Travel Alarm Clock with Backlight, 12/24H Display, Calendar and Temperature, Weekend Mode, Compact Portable Design for Bedside Desk, Battery Operated(White)

Generic£7.91Buy on AmazonPrice checked 12/10/2026

Hair Straightener Comb 4 Temp Adjustable Quick Styling Comb

Hair Straightener Comb 4 Temp Adjustable Quick Styling Comb

Hasihendy£5.09Buy on AmazonPrice checked 12/10/2026

Digital LCD Travel Alarm Clock Small Folding Date Day Calendar Temperature

Digital LCD Travel Alarm Clock Small Folding Date Day Calendar Temperature

Fuitke£6.99Buy on AmazonPrice checked 12/10/2026

MERTTURM Magnetic Cruise Desk Fan, 10000mAh USB Rechargeable Portable Travel Table Fan with 27H Runtime&4-Speed&Timer&Night Light&Hook&LED Display, Ultra-Silm Quiet Camping Fan for Home/Outdoor/Cruise

MERTTURM Magnetic Cruise Desk Fan, 10000mAh USB Rechargeable Portable Travel Table Fan with 27H Runtime&4-Speed&Timer&Night Light&Hook&LED Display, Ultra-Silm Quiet Camping Fan for Home/Outdoor/Cruise

MERTTURM£34.99Buy on AmazonPrice checked 12/10/2026

Magnetic Cruise Approved Fan with Night Light, 10000mAh Ultra-Slim Travel Fan, 4-Speed, Hook Design, Portable Fan for Cruise Ship Cabin, Bedroom Sleeping, Camping, Travel & Cruise Essentials 2026

Magnetic Cruise Approved Fan with Night Light, 10000mAh Ultra-Slim Travel Fan, 4-Speed, Hook Design, Portable Fan for Cruise Ship Cabin, Bedroom Sleeping, Camping, Travel & Cruise Essentials 2026

DRIFWIN£31.44Buy on AmazonPrice checked 12/10/2026

Cruise Ship Approved Magnetic Fan, Portable Rechargeable USB-C Travel Fan with Space-Saving Design, 4-Speed Adjustable & Ultra Quiet, Desk Fans 2026 Cruises (Gray)

Cruise Ship Approved Magnetic Fan, Portable Rechargeable USB-C Travel Fan with Space-Saving Design, 4-Speed Adjustable & Ultra Quiet, Desk Fans 2026 Cruises (Gray)

Generic£6.95Buy on AmazonPrice checked 12/10/2026

SOQSYS Cruise Approved Fan with 4000mAh Battery, Portable Fan for Cruise Magnetic Hook Included to Hang on Cabin Walls, 5-Speed Tavel Fan for Hotel Bedside Sleeping Cruise Ship Essentials

SOQSYS Cruise Approved Fan with 4000mAh Battery, Portable Fan for Cruise Magnetic Hook Included to Hang on Cabin Walls, 5-Speed Tavel Fan for Hotel Bedside Sleeping Cruise Ship Essentials

SOQSYS£21.99Buy on AmazonPrice checked 12/10/2026

Magnetic Travel Fan, 5000mAh Ultra-Slim Cruise Approved Fan Rechargeable, 4-Speed, Hook Design, Portable Fan for Cruise Ship Cabin, Bedroom Sleeping, Camping, Travel & Cruise Essentials 2026

Magnetic Travel Fan, 5000mAh Ultra-Slim Cruise Approved Fan Rechargeable, 4-Speed, Hook Design, Portable Fan for Cruise Ship Cabin, Bedroom Sleeping, Camping, Travel & Cruise Essentials 2026

DRIFWIN£24.99Buy on AmazonPrice checked 12/10/2026

2-Pack Magnetic Cruise Approved Fan, 5000mAh Ultra-Slim Travel Fan Rechargeable, 4-Speed, Hook Design, Portable Fan for Cruise Ship Cabin, Bedroom Sleeping, Camping, Travel & Cruise Essentials 2026

2-Pack Magnetic Cruise Approved Fan, 5000mAh Ultra-Slim Travel Fan Rechargeable, 4-Speed, Hook Design, Portable Fan for Cruise Ship Cabin, Bedroom Sleeping, Camping, Travel & Cruise Essentials 2026

DRIFWIN£39.97Buy on AmazonPrice checked 12/10/2026

ELZO Magnetic Travel Fan for Cruise Ship Cabin, 5000mAh Rechargeable Portable, 4-Speed Quiet Operation with Hook, Cruise Approved Essentials 2026 for Ceiling & Wall

ELZO Magnetic Travel Fan for Cruise Ship Cabin, 5000mAh Rechargeable Portable, 4-Speed Quiet Operation with Hook, Cruise Approved Essentials 2026 for Ceiling & Wall

ELZO£23.99Buy on AmazonPrice checked 12/10/2026

Warmco D3 Portable Rechargeable Desk Fan 10000mAh, 15-24H Battery Life

Warmco D3 Portable Rechargeable Desk Fan 10000mAh, 15-24H Battery Life

Warmco£34.99Buy on AmazonPrice checked 12/10/2026

Bearwind Portable Handheld Turbo Fan, 5-Speed High Airflow, 4000mAh Battery

Bearwind Portable Handheld Turbo Fan, 5-Speed High Airflow, 4000mAh Battery

Bearwind£22.94Buy on AmazonPrice checked 12/10/2026

Outdoor Portable Camping Shower with 1500mAh Rechargeable Battery Waterproof Handheld Water Pump with Hose for Hiking, Beach, Car Washing & Pet Bathing

Outdoor Portable Camping Shower with 1500mAh Rechargeable Battery Waterproof Handheld Water Pump with Hose for Hiking, Beach, Car Washing & Pet Bathing

Generic£14.99Buy on AmazonPrice checked 12/10/2026

Zonopy Silent Analog Alarm Clock with Night Light, Battery Operated, Loud Alarm, Snooze, Bright Screen, Portable Design, Travel Clock, Back to School Gfits

Zonopy Silent Analog Alarm Clock with Night Light, Battery Operated, Loud Alarm, Snooze, Bright Screen, Portable Design, Travel Clock, Back to School Gfits

Zonopy£5.64Buy on AmazonPrice checked 12/10/2026

VTOMAN FlashSpeed 300 Portable Power Station – 230Wh LiFePO4 Battery

VTOMAN FlashSpeed 300 Portable Power Station – 230Wh LiFePO4 Battery

VTOMAN£94.99Buy on AmazonPrice checked 12/10/2026

Rexhan 550W Portable Power Station, LiFePO4 Battery, Mobile Battery Power, Solar Generator, Emergency Outdoor Power, 120W Solar Panel, 2026 Version, 240V AC Outlet, Outdoor, Camping, RVs, USB-C

Rexhan 550W Portable Power Station, LiFePO4 Battery, Mobile Battery Power, Solar Generator, Emergency Outdoor Power, 120W Solar Panel, 2026 Version, 240V AC Outlet, Outdoor, Camping, RVs, USB-C

Generic£219.99Buy on AmazonPrice checked 12/10/2026

GVODE Portable Coffee Machine with Battery, 20 Bar Espresso Machine 3-in-1

GVODE Portable Coffee Machine with Battery, 20 Bar Espresso Machine 3-in-1

GVODE£99.99Buy on AmazonPrice checked 12/10/2026

Firexo All in One Stainless Steel Fire Extinguisher 500ml Chrome - Multipurpose Extinguisher for ALL FIRES inc. Li-ion Battery Fires! - Emergency Safety Equipment for Home Car Indoor/Outdoor

Firexo All in One Stainless Steel Fire Extinguisher 500ml Chrome - Multipurpose Extinguisher for ALL FIRES inc. Li-ion Battery Fires! - Emergency Safety Equipment for Home Car Indoor/Outdoor

Firexo£32.04Buy on AmazonPrice checked 12/10/2026

Firexo All in One Fire Extinguisher (6 Litre / 6 kg) - Multipurpose Extinguisher for All Fires inc. Li-ion Battery Fires! - Safety & Emergency Equipment for Home, Kitchen, Fireplace, Grill, Caravan

Firexo All in One Fire Extinguisher (6 Litre / 6 kg) - Multipurpose Extinguisher for All Fires inc. Li-ion Battery Fires! - Safety & Emergency Equipment for Home, Kitchen, Fireplace, Grill, Caravan

Firexo£88.99Buy on AmazonPrice checked 12/10/2026

iYeHo Solar-Powered Camping Fan with LED Lantern,10400mAh Rechargeable Battery Operated Portable,Timer,Phone Charging and Eco-Friendly Fan,for Camping,Fishing, Power Outage,Hurricane,Travel

iYeHo Solar-Powered Camping Fan with LED Lantern,10400mAh Rechargeable Battery Operated Portable,Timer,Phone Charging and Eco-Friendly Fan,for Camping,Fishing, Power Outage,Hurricane,Travel

iYeHo£32.99Buy on AmazonPrice checked 12/10/2026

Emergency Radio with Solar, Hand Crank & USB-C Charging 2600mAh Battery

Emergency Radio with Solar, Hand Crank & USB-C Charging 2600mAh Battery

BAIJIALI£24.99Buy on AmazonPrice checked 12/10/2026

AFERIY P280 4096Wh Portable Power Station,with 1 Extra Battery,2800W Expandable Capacity LiFePO4 Battery Backup,Solar Generator for Home Use,Outdoor Camping,Power Outage,Camping,RV,Emergencies

AFERIY P280 4096Wh Portable Power Station,with 1 Extra Battery,2800W Expandable Capacity LiFePO4 Battery Backup,Solar Generator for Home Use,Outdoor Camping,Power Outage,Camping,RV,Emergencies

AFERIY£1,288.99Buy on AmazonPrice checked 12/10/2026

Portable Air Cooler, Mini Air Conditioner with 1800mAh Battery & Water Tank

Portable Air Cooler, Mini Air Conditioner with 1800mAh Battery & Water Tank

YUNIBRIX£19.99Buy on AmazonPrice checked 12/10/2026

Bellanny 60Bar Cordless Pressure Washer, 21V 1500W Portable Pressure Washer with 2 x 2.0Ah Rechargeable Battery, Battery Pressure Washer with 5M Hose for Floor Car Garden Cleaning - with Bucket

Bellanny 60Bar Cordless Pressure Washer, 21V 1500W Portable Pressure Washer with 2 x 2.0Ah Rechargeable Battery, Battery Pressure Washer with 5M Hose for Floor Car Garden Cleaning - with Bucket

Bellanny£25.99Buy on AmazonPrice checked 12/10/2026

Gaiatop Portable Pedestal Fan, 16000mAh Battery, Max 74 Hours Runtime, Foldable Oscillating Pedestal Fan, Folding Desk Fan, LED Light, Case and Remote Control

Gaiatop Portable Pedestal Fan, 16000mAh Battery, Max 74 Hours Runtime, Foldable Oscillating Pedestal Fan, Folding Desk Fan, LED Light, Case and Remote Control

gaiatop£51.46Buy on AmazonPrice checked 12/10/2026

Bellanny 60Bar Cordless Pressure Washer, 21V 1500W Portable Pressure Washer with 2 x 2.0Ah Rechargeable Battery, Battery Pressure Washer with 5M Hose for Floor Car Garden Cleaning & Watering

Bellanny 60Bar Cordless Pressure Washer, 21V 1500W Portable Pressure Washer with 2 x 2.0Ah Rechargeable Battery, Battery Pressure Washer with 5M Hose for Floor Car Garden Cleaning & Watering

Bellanny£23.99Buy on AmazonPrice checked 12/10/2026

Cordless Table Lamp Set of 2,Rechargeable Touch Lamps Bedside Lamps,3000-6000k Dimmable Waterproof Wireless LED Table Lamp,Protable Battery Operated Lamp for Home Shower Bedroom Living Room (Silver)

Cordless Table Lamp Set of 2,Rechargeable Touch Lamps Bedside Lamps,3000-6000k Dimmable Waterproof Wireless LED Table Lamp,Protable Battery Operated Lamp for Home Shower Bedroom Living Room (Silver)

VIMAZ£29.99Buy on AmazonPrice checked 12/10/2026

KASIMO Single Inflatable Mattress, Airbed with Built-In Battery Pump

KASIMO Single Inflatable Mattress, Airbed with Built-In Battery Pump

KASIMO£89.99Buy on AmazonPrice checked 12/10/2026

Miady for Magsafe Power Bank, 5000mAh Magnetic Slim Portable Charger

Miady for Magsafe Power Bank, 5000mAh Magnetic Slim Portable Charger

Miady£11.89Buy on AmazonPrice checked 12/10/2026

Rexhan 300W Portable Power Station, LiFePO4 Battery, Mobile Battery Power, Solar Generator, Emergency Outdoor Power, 50W Solar Panel, 2025 Version, 240V AC Outlet, RVs, Camping, Outdoor, USB-C (300W)

Rexhan 300W Portable Power Station, LiFePO4 Battery, Mobile Battery Power, Solar Generator, Emergency Outdoor Power, 50W Solar Panel, 2025 Version, 240V AC Outlet, RVs, Camping, Outdoor, USB-C (300W)

Generic£129.99Buy on AmazonPrice checked 12/10/2026

Battery Operated Phone Charger Emergency|USB Battery Powered Power Bank Portable 4 AA Batteries Powered Outlet (Black)

Battery Operated Phone Charger Emergency|USB Battery Powered Power Bank Portable 4 AA Batteries Powered Outlet (Black)

LZDICITARU£9.96Buy on AmazonPrice checked 12/10/2026

OBEST Electric Air Pump, Battery Powered, Portable USB Mini Inflator/Deflator for Inflatables, Mattress, Pool, Outdoor Pool, Boat

OBEST Electric Air Pump, Battery Powered, Portable USB Mini Inflator/Deflator for Inflatables, Mattress, Pool, Outdoor Pool, Boat

OBEST£12.98Buy on AmazonPrice checked 12/10/2026

WOLFBOX 4000A Jump Starter Power Pack with 65W Quick Charger, MV24

WOLFBOX 4000A Jump Starter Power Pack with 65W Quick Charger, MV24

WOLFBOX£99.99Buy on AmazonPrice checked 12/10/2026

FOSSiBOT F2400 Portable Power Station 2048Wh, 2400W Battery Backup for Home Power Cuts, <10ms UPS Emergency Power Supply, 240V UK Sockets LiFePO4 Generator for Garage, DIY & CPAP, Black

FOSSiBOT F2400 Portable Power Station 2048Wh, 2400W Battery Backup for Home Power Cuts, <10ms UPS Emergency Power Supply, 240V UK Sockets LiFePO4 Generator for Garage, DIY & CPAP, Black

FOSSiBOT£649.00Buy on AmazonPrice checked 12/10/2026

Amazon Basics Portable Digital Air Compressor, Heavy Duty Tyre Inflator with 12V DC Dual Cylinder, 120 PSI, 60L/Min, Auto Shut-Off, LED Light, 5M Hose, Battery Clamps, Carrying Case, Black/Red

Amazon Basics Portable Digital Air Compressor, Heavy Duty Tyre Inflator with 12V DC Dual Cylinder, 120 PSI, 60L/Min, Auto Shut-Off, LED Light, 5M Hose, Battery Clamps, Carrying Case, Black/Red

Amazon Basics£43.69Buy on AmazonPrice checked 12/10/2026

8000A Jump Starter Power Pack with Air Compressor 160PSI & Blower, ANFLAG 12V Car Battery Booster Jump Starter (All Gas/14L Diesel) Portable Car Jump Starter Power Bank with Jump Leads/800LM Light

8000A Jump Starter Power Pack with Air Compressor 160PSI & Blower, ANFLAG 12V Car Battery Booster Jump Starter (All Gas/14L Diesel) Portable Car Jump Starter Power Bank with Jump Leads/800LM Light

ANFLAG£97.99Buy on AmazonPrice checked 12/10/2026

Jackery Explorer 100 Plus, 99Wh & 31000mAh LiFePO4 Portable Power Station

Jackery Explorer 100 Plus, 99Wh & 31000mAh LiFePO4 Portable Power Station

Jackery£75.00Buy on AmazonPrice checked 12/10/2026

DEWINNER 32V Cordless Battery Powered Pressure Washer, 700PSI Portable Pressure Washer with 5-in-1 Adjustable Nozzle Suitable for Washing Cars/Fences/Siding

DEWINNER 32V Cordless Battery Powered Pressure Washer, 700PSI Portable Pressure Washer with 5-in-1 Adjustable Nozzle Suitable for Washing Cars/Fences/Siding

DEWINNER£39.99Buy on AmazonPrice checked 12/10/2026

EasyAcc Handheld Fan, Portable, Battery, USB Fan/Portable Mini Fan, Electric, 20 Hour Rechargeable Battery, Foldable, Compatible with Laptop Multi Port Socket for Travel, Home, White

EasyAcc Handheld Fan, Portable, Battery, USB Fan/Portable Mini Fan, Electric, 20 Hour Rechargeable Battery, Foldable, Compatible with Laptop Multi Port Socket for Travel, Home, White

EasyAcc£21.24Buy on AmazonPrice checked 12/10/2026

Battery Operated MP3 Player Featuring Direct USB, Expandable Memory Card, LCD Screen Music Player

Battery Operated MP3 Player Featuring Direct USB, Expandable Memory Card, LCD Screen Music Player

YUGSHNKFC£6.99Buy on AmazonPrice checked 12/10/2026

Yinhing 128 Gb MP3 Music Player budget-friendly Portable MP3 Player with Built in Battery Slim .8 LCD Screen Supports TF Card Lightweight Design Multi Color Options for Students and Audiophiles

Yinhing 128 Gb MP3 Music Player budget-friendly Portable MP3 Player with Built in Battery Slim .8 LCD Screen Supports TF Card Lightweight Design Multi Color Options for Students and Audiophiles

Yinhing£11.11Buy on AmazonPrice checked 12/10/2026

Yinhing 128 Gb MP3 Music Player budget-friendly Portable MP3 Player with Built in Battery Slim .8 LCD Screen Supports TF Card Lightweight Design Multi Color Options for Students and Audiophiles (Blue)

Yinhing 128 Gb MP3 Music Player budget-friendly Portable MP3 Player with Built in Battery Slim .8 LCD Screen Supports TF Card Lightweight Design Multi Color Options for Students and Audiophiles (Blue)

Yinhing£11.15Buy on AmazonPrice checked 12/10/2026

Yinhing 128 Gb MP3 Music Player budget-friendly Portable MP3 Player with Built in Battery Slim .8 LCD Screen Supports TF Card Lightweight Design Multi Color Options for Students and Audiophiles

Yinhing 128 Gb MP3 Music Player budget-friendly Portable MP3 Player with Built in Battery Slim .8 LCD Screen Supports TF Card Lightweight Design Multi Color Options for Students and Audiophiles

Yinhing£11.16Buy on AmazonPrice checked 12/10/2026

Yinhing 128 Gb MP3 Music Player budget-friendly Portable MP3 Player with Built in Battery Slim .8 LCD Screen Supports TF Card Lightweight Design Multi Color Options for Students and Audiophiles

Yinhing 128 Gb MP3 Music Player budget-friendly Portable MP3 Player with Built in Battery Slim .8 LCD Screen Supports TF Card Lightweight Design Multi Color Options for Students and Audiophiles

Yinhing£11.14Buy on AmazonPrice checked 12/10/2026

LUCKDANO budget-friendly Players Portable Portable Digital Music Media Player MP3 with Back Clip & Earphone, Lightweight Aluminum, 5-Hour Battery Life, Expandable Up to 8GB, Ideal for Sports &

LUCKDANO budget-friendly Players Portable Portable Digital Music Media Player MP3 with Back Clip & Earphone, Lightweight Aluminum, 5-Hour Battery Life, Expandable Up to 8GB, Ideal for Sports &

LUCKDANO£5.46Buy on AmazonPrice checked 12/10/2026

LUCKDANO budget-friendly Players Portable Portable Digital Music Media Player MP3 with Back Clip & Earphone, Lightweight Aluminum, 5-Hour Battery Life, Expandable Up to 8GB, Ideal for Sports & (Black)

LUCKDANO budget-friendly Players Portable Portable Digital Music Media Player MP3 with Back Clip & Earphone, Lightweight Aluminum, 5-Hour Battery Life, Expandable Up to 8GB, Ideal for Sports & (Black)

LUCKDANO£5.22Buy on AmazonPrice checked 12/10/2026

Bestway Premium Camping Double Airbed with Cordless Battery Pump

Bestway Premium Camping Double Airbed with Cordless Battery Pump

Bestway£23.99Buy on AmazonPrice checked 12/10/2026

MOCEL Water Dental Flosser Oral Irrigator with 5 Modes, 350ml Cordless Water Teeth Cleaner Pick 6 Tips, IPX7 Waterproof Rechargeable Portable Powerful Battery for Travel & Home Braces & Bridges Care

MOCEL Water Dental Flosser Oral Irrigator with 5 Modes, 350ml Cordless Water Teeth Cleaner Pick 6 Tips, IPX7 Waterproof Rechargeable Portable Powerful Battery for Travel & Home Braces & Bridges Care

Mocel£19.99Buy on AmazonPrice checked 12/10/2026

Rechargeable 30W LED Work Light,3 Modes 2000LM Portable COB Floodlight Waterproof Camping Lights, Security Lights Outdoor for Garage Hiking Fishing Emergency (Batteries Included)

Rechargeable 30W LED Work Light,3 Modes 2000LM Portable COB Floodlight Waterproof Camping Lights, Security Lights Outdoor for Garage Hiking Fishing Emergency (Batteries Included)

flintronic£11.99Buy on AmazonPrice checked 12/10/2026

SYLSTAR 30W Rechargeable Work Light, 3000 Lumen Magnetic Work Light Battery Powered, Waterproof Portable Cordless Job Site Lighting for Construction Site, Workshop, Garage, Camping, and Car Repairing

SYLSTAR 30W Rechargeable Work Light, 3000 Lumen Magnetic Work Light Battery Powered, Waterproof Portable Cordless Job Site Lighting for Construction Site, Workshop, Garage, Camping, and Car Repairing

SYLSTAR£33.99Buy on AmazonPrice checked 12/10/2026

Beizkna 30W LED Work Light Rechargeable Portable COB Floodlight Waterproof

Beizkna 30W LED Work Light Rechargeable Portable COB Floodlight Waterproof

Beizkna£12.98Buy on AmazonPrice checked 12/10/2026

FM AM SW Transistor Radio with Rechargeable Battery, Portable Pocket Radio with Full Shortwave, Mini Battery Operated Shortwave Emergency Tool, Type C Charging & Headphone Jack(Full Shortwave Version)

FM AM SW Transistor Radio with Rechargeable Battery, Portable Pocket Radio with Full Shortwave, Mini Battery Operated Shortwave Emergency Tool, Type C Charging & Headphone Jack(Full Shortwave Version)

Handsider£11.99Buy on AmazonPrice checked 12/10/2026

XHDATA D220 Shortwave Radios FM AM Retro Portable Radio Battery Powered Radio (AA), World Receiver with Excellent Reception and Speaker, Suitable for Outdoor, Elderly (Green)

XHDATA D220 Shortwave Radios FM AM Retro Portable Radio Battery Powered Radio (AA), World Receiver with Excellent Reception and Speaker, Suitable for Outdoor, Elderly (Green)

XHDATA£12.89Buy on AmazonPrice checked 12/10/2026

Cordless Hair Straighteners, 2 in 1 Mini Hair Straightener and Curler with 4 Temp Settings & Fast Heating, USB Rechargeable Travel Straighteners Mini Portable for Short to Long (Black)

Cordless Hair Straighteners, 2 in 1 Mini Hair Straightener and Curler with 4 Temp Settings & Fast Heating, USB Rechargeable Travel Straighteners Mini Portable for Short to Long (Black)

Rppiup£16.99Buy on AmazonPrice checked 12/10/2026

Portable Standing Pedestal Fan Rechargeable - 3600mAh Electric Silent Oscillating Floor Fan with Remote Control,USB Battery Telescopic Foldable Desk Table Fans for Bedroom Camping Travel (White)

Portable Standing Pedestal Fan Rechargeable - 3600mAh Electric Silent Oscillating Floor Fan with Remote Control,USB Battery Telescopic Foldable Desk Table Fans for Bedroom Camping Travel (White)

SpirWoRchlan£16.99Buy on AmazonPrice checked 12/10/2026

Portable Foldable Fan, 3-in-1 Rechargeable Pedestal & Desk Fan, 7200mAh Battery, Foldable Standing Fan, 39" Height Adjustable, 4 Speeds Quiet Telescopic Fan, USB Cordless Fan for Home, Camping (Pink)

Portable Foldable Fan, 3-in-1 Rechargeable Pedestal & Desk Fan, 7200mAh Battery, Foldable Standing Fan, 39" Height Adjustable, 4 Speeds Quiet Telescopic Fan, USB Cordless Fan for Home, Camping (Pink)

NPLSEO£17.99Buy on AmazonPrice checked 12/10/2026

Rechargeable LED Table Lamp & Cordless Lantern – Minimalist Touch Control

Rechargeable LED Table Lamp & Cordless Lantern – Minimalist Touch Control

Pluto Packaging£16.95Buy on AmazonPrice checked 12/10/2026

NPLSEO Portable Foldable Fan, 3-in-1 Rechargeable Pedestal & Desk Fan, 7200mAh Battery, Foldable Standing Fan, 39" Height Adjustable, 4 Speeds Quiet Telescopic Fan, USB Cordless Fan for Home, Camping

NPLSEO Portable Foldable Fan, 3-in-1 Rechargeable Pedestal & Desk Fan, 7200mAh Battery, Foldable Standing Fan, 39" Height Adjustable, 4 Speeds Quiet Telescopic Fan, USB Cordless Fan for Home, Camping

NPLSEO£17.99Buy on AmazonPrice checked 12/10/2026

HSLighting Rechargeable Lamp, 5000mAh Touch Cordless Table Lamps Bedside

HSLighting Rechargeable Lamp, 5000mAh Touch Cordless Table Lamps Bedside

HSLighting£29.99Buy on AmazonPrice checked 12/10/2026

Portable Standing Fan, 3-in-1 Foldable Pedestal Fan, 7200mAh Battery, USB Rechargeable Fan with 4 Speeds, Height Adjustable Telescopic Floor & Desk Fan, Quiet Fan for Home, Office, Camping (white)

Portable Standing Fan, 3-in-1 Foldable Pedestal Fan, 7200mAh Battery, USB Rechargeable Fan with 4 Speeds, Height Adjustable Telescopic Floor & Desk Fan, Quiet Fan for Home, Office, Camping (white)

MQLAE£17.99Buy on AmazonPrice checked 12/10/2026

Lepro Camping Lantern Battery Powered, Portable Small Camping Tent Lights

Lepro Camping Lantern Battery Powered, Portable Small Camping Tent Lights

Lepro£8.48Buy on AmazonPrice checked 12/10/2026

ECO-WORTHY 2400W Portable Power Station with 2048Wh LiFePO4 Battery

ECO-WORTHY 2400W Portable Power Station with 2048Wh LiFePO4 Battery

ECO-WORTHY£619.99Buy on AmazonPrice checked 12/10/2026

KFUBUO Heated Electric Wearable Blanket Throw Battery Operated Portable USB Cordless Outdoor Hoodie Sweatshirt (Heated Blanket Light Grey)

KFUBUO Heated Electric Wearable Blanket Throw Battery Operated Portable USB Cordless Outdoor Hoodie Sweatshirt (Heated Blanket Light Grey)

KFUBUO£53.56Buy on AmazonPrice checked 12/10/2026

VTOMAN Jump 600X Portable Power Station 299Wh LiFePO4 Battery, 60W USB-C

VTOMAN Jump 600X Portable Power Station 299Wh LiFePO4 Battery, 60W USB-C

VTOMAN£219.99Buy on AmazonPrice checked 12/10/2026

Power Bank 10000mAh, 5V/2.4A Dual USB A Fast Charging Portable Charger, Slim Lightweight External Battery Pack for iPhone 14 13 12 11 iPads Android and More

Power Bank 10000mAh, 5V/2.4A Dual USB A Fast Charging Portable Charger, Slim Lightweight External Battery Pack for iPhone 14 13 12 11 iPads Android and More

IAIGG£9.86Buy on AmazonPrice checked 12/10/2026

50000mAh Power Bank with Built-in Cable: 22.5W Fast Charging External Battery with Large Capacity, Portable Charger with LED Flashlight and 7 Outputs & 3 Inputs-White

50000mAh Power Bank with Built-in Cable: 22.5W Fast Charging External Battery with Large Capacity, Portable Charger with LED Flashlight and 7 Outputs & 3 Inputs-White

Powelephant£38.99Buy on AmazonPrice checked 12/10/2026

DAB Radio Portable, DAB Plus/DAB Radio, FM Radio, Small Radio, XL Large LCD Display Portable Radios Mains and Battery, USB Charging for 10 Hours Playback, (Spectrum by iBox)

DAB Radio Portable, DAB Plus/DAB Radio, FM Radio, Small Radio, XL Large LCD Display Portable Radios Mains and Battery, USB Charging for 10 Hours Playback, (Spectrum by iBox)

i-box£34.99Buy on AmazonPrice checked 12/10/2026

JBL Tuner XL Powerful Portable Radio, Bluetooth Speaker with DAB and FM Radio, 15 Hours of Wireless Music, Black

JBL Tuner XL Powerful Portable Radio, Bluetooth Speaker with DAB and FM Radio, 15 Hours of Wireless Music, Black

JBL£79.99Buy on AmazonPrice checked 12/10/2026

DBPOWER 16.9" Portable DVD Player with 14.1" Swivel HD Large Screen, with 6 Hrs 5000mAH Rechargeable Battery, High Volume Speaker, Support DVD/USB/SD Card and Multiple Disc Formats

DBPOWER 16.9" Portable DVD Player with 14.1" Swivel HD Large Screen, with 6 Hrs 5000mAH Rechargeable Battery, High Volume Speaker, Support DVD/USB/SD Card and Multiple Disc Formats

DBPOWER£67.99Buy on AmazonPrice checked 12/10/2026

Jackery Explorer 1000 v2, 1500W 1070Wh LiFePO4 Portable Power Station

Jackery Explorer 1000 v2, 1500W 1070Wh LiFePO4 Portable Power Station

Jackery£418.99Buy on AmazonPrice checked 12/10/2026

6-Inch Rechargeable Small Desk Fan, Portable Battery-Operated USB Table Electric Fan with 4 Speed Levels, Personal Mini Ventilator for Home Bed Study Room Bedroom Office Camping Cooling-Quite & Silent

6-Inch Rechargeable Small Desk Fan, Portable Battery-Operated USB Table Electric Fan with 4 Speed Levels, Personal Mini Ventilator for Home Bed Study Room Bedroom Office Camping Cooling-Quite & Silent

TRILINK£22.99Buy on AmazonPrice checked 12/10/2026

JZF High-Speed Automatic Pencil Sharpener, Portable Battery-Powered Coloured Pencil Sharpener, Perfect for Kids Students and Personal Use at Home School or Office

JZF High-Speed Automatic Pencil Sharpener, Portable Battery-Powered Coloured Pencil Sharpener, Perfect for Kids Students and Personal Use at Home School or Office

JZF£6.99Buy on AmazonPrice checked 12/10/2026

EJXHKNF Digital Camera, 1080P FHD Vlogging Camera 50MP Compact Portable Photo Camera with 2.4" Screen, 16X Digital Zoom Mini Small Pocket Camera for Kids Students with 1 Battery, 16GB Card (Black)

EJXHKNF Digital Camera, 1080P FHD Vlogging Camera 50MP Compact Portable Photo Camera with 2.4" Screen, 16X Digital Zoom Mini Small Pocket Camera for Kids Students with 1 Battery, 16GB Card (Black)

EJXHKNF£29.99Buy on AmazonPrice checked 12/10/2026

Digital Travel Alarm Clock, 2-Level Backlight, 2 Volumes, Snooze & Weekend

Digital Travel Alarm Clock, 2-Level Backlight, 2 Volumes, Snooze & Weekend

MeesMeek£13.44Buy on AmazonPrice checked 12/10/2026

HOTUT Cordless Electric Nail Drill File, 23000RPM Professional Nail Drill Machine for Beginners, Portable Manicure Pedicure Set with 6 Drill Bits 20 Sanding Bands, E File for Acrylic & Gel Nails

HOTUT Cordless Electric Nail Drill File, 23000RPM Professional Nail Drill Machine for Beginners, Portable Manicure Pedicure Set with 6 Drill Bits 20 Sanding Bands, E File for Acrylic & Gel Nails

HOTUT£7.49Buy on AmazonPrice checked 12/10/2026

COSLUS C52 Cordless Electric Nail Drill File: Professional Nail Drill Kit with LED Screen for Acrylic Gel Nails, Portable for Home DIY & Salon Use, Manicure Pedicure for Beginners, Women, Dark Gray

COSLUS C52 Cordless Electric Nail Drill File: Professional Nail Drill Kit with LED Screen for Acrylic Gel Nails, Portable for Home DIY & Salon Use, Manicure Pedicure for Beginners, Women, Dark Gray

COSLUS£16.99Buy on AmazonPrice checked 12/10/2026

Portable Color Temperature Lamp Stick, Professional Rechargeable 2700K‑6000K 6 Modes Photography Light Wand, 800mAh Battery for Vlog, Live Stream, Photography

Portable Color Temperature Lamp Stick, Professional Rechargeable 2700K‑6000K 6 Modes Photography Light Wand, 800mAh Battery for Vlog, Live Stream, Photography

Tyenaza£14.29Buy on AmazonPrice checked 12/10/2026

Vicloon Cordless Electric Nail Drill, 12 in 1 Rechargeable Nail File Kit 26000RPM 3 Speeds, Professional Portable Nails Kit with Bits & Sanding Bands for Beginners, for Acrylic & Gel, Pink

Vicloon Cordless Electric Nail Drill, 12 in 1 Rechargeable Nail File Kit 26000RPM 3 Speeds, Professional Portable Nails Kit with Bits & Sanding Bands for Beginners, for Acrylic & Gel, Pink

Vicloon£15.99Buy on AmazonPrice checked 12/10/2026

POSEIDON Wireless Tattoo Machine Kit with 20 Tattoo Cartridge Needles, Ink Set & 2 Rechargeable Batteries | Professional Portable Tattoo Pen Gun Set for Beginners | Complete Starter Supplies(PTK052)

POSEIDON Wireless Tattoo Machine Kit with 20 Tattoo Cartridge Needles, Ink Set & 2 Rechargeable Batteries | Professional Portable Tattoo Pen Gun Set for Beginners | Complete Starter Supplies(PTK052)

POSEIDON£35.99Buy on AmazonPrice checked 12/10/2026

Denabuty Electric Nail Drill Cordless, 13 in 1 Nail File 35000RPM for Gel

Denabuty Electric Nail Drill Cordless, 13 in 1 Nail File 35000RPM for Gel

Denabuty£19.95Buy on AmazonPrice checked 12/10/2026

August MB225W Portable DAB/DAB+/FM Radio, Dual Alarm, Sleep Timer, RDS

August MB225W Portable DAB/DAB+/FM Radio, Dual Alarm, Sleep Timer, RDS

August£29.95Buy on AmazonPrice checked 12/10/2026

PRUNUS J-139 Portable Radio AM/FM/SW, Solar Radio,Transistor Radio

PRUNUS J-139 Portable Radio AM/FM/SW, Solar Radio,Transistor Radio

PRUNUS£16.99Buy on AmazonPrice checked 12/10/2026

Page 4 of 9

Tours, activities and things to do across the UK & Ireland — hand-picked and organised by destination.

As an affiliate partner, we may earn a commission when you book a tour through a link on this site — at no extra cost to you.

Secure booking via Viator
Encrypted checkout & payment
Free cancellation on most tours

Destinations

England
Scotland
Ireland
Wales
Northern Ireland
All destinations
Sitemap

Popular categories

Punting
Walking Tours
Food Tours
Seasonal Events
Ghost Tours
Day Trips
Bike Tours
Museums
All things to do

Guides

Best Things to Do in Cambridge
Best Things to Do in London
Best Things to Do in York
Best Things to Do in Edinburgh
Best Things to Do in Oxford
Oxford Travel Guide

Company

Travel gear shop
Travel tools
About
Contact

© 2026 Trailspot. All rights reserved.

Editorial Policy
Privacy Policy
Affiliate Disclosure
Terms of Use
Cookie Policy
Accessibility